PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100034290001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HSF
Protein Properties Length: 94aa    MW: 10974.4 Da    PI: 7.6811
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100034290001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind86.92.7e-272179260
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                  Fl+k+y++++d++++++isw+++g++f+v+++ efa+++LpkyFkh+nf+SFvRQLn+Y
  Ote100034290001|100034290001 21 FLTKTYQLVDDHSVDDVISWNADGTTFIVWNQAEFARDLLPKYFKHNNFSSFVRQLNTY 79
                                  9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.4E-281580IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.8E-271788IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.38E-241880IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.4E-162144IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.2E-232180IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-165971IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-167284IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MERKGGESYG EDMPRLVPTP FLTKTYQLVD DHSVDDVISW NADGTTFIVW NQAEFARDLL  60
PKYFKHNNFS SFVRQLNTYV INPSISARLT LRFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B3e-1910791987Heat shock factor protein 1
5d5v_B3e-1910791987Heat shock factor protein 1
5d5v_D3e-1910791987Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076201.11e-40heat stress transcription factor B-2a
RefseqXP_011076202.11e-40heat stress transcription factor B-2a
RefseqXP_028108220.15e-41heat stress transcription factor B-2a
SwissprotQ6Z9C82e-35HFB2B_ORYSJ; Heat stress transcription factor B-2b
TrEMBLA0A2Z4K5C04e-42A0A2Z4K5C0_TECGR; HSF2 protein
STRINGMigut.F00357.1.p7e-40(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xiang J, et al.
    Heat shock factor OsHsfB2b negatively regulates drought and salt tolerance in rice.
    Plant Cell Rep., 2013. 32(11): p. 1795-806
    [PMID:23949687]