PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100023940121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 160aa    MW: 17826.1 Da    PI: 8.1329
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100023940121genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.31.8e-45111101100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca+dCv+ pyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i+
  Ote100023940121|100023940121  11 PCAACKLLRRRCAEDCVFEPYFPADEPHKFASVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAIS 91 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lqqq+++l+++lal+++e
  Ote100023940121|100023940121  92 SLQQQIDSLQTQLALAQAE 110
                                   **************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.79510111IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4511108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MKERKQGAAA PCAACKLLRR RCAEDCVFEP YFPADEPHKF ASVHKVFGAS NVNKMLQELP  60
EHQRGDAVSS MVYEANARVR DPVYGCVGAI SSLQQQIDSL QTQLALAQAE VVHMRMRQYS  120
SNSSSPDNAS PSARGRRSHQ AKNQSCFNMD MANMDDSFWP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090495.17e-96PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-67LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A022S1U05e-92A0A022S1U0_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000222862e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669