PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100003460061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 225aa    MW: 24947.7 Da    PI: 9.617
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100003460061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.36.5e-32128554128
                           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Ote100003460061|100003460061  12 GEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 85 
                                   689**********************************9999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100542.31108IPR003441NAC domain
SuperFamilySSF1019412.09E-428109IPR003441NAC domain
PfamPF023652.9E-151585IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSDSSPCKAL FGEKEWYFFS PRDRKYPNGS RPNRVAGSGY WKATGTDKII TTEGRKVGIK  60
KALVFYIGKA PKGTKTNWIM HEYRLSESPR KSGSSKLDDW VLCRIYKKNT SSHDRSAVAG  120
IRSNEYNHDS SSSSSSQYDD VLDSLPELDD PGLNPVWPEI QAQHGPVQPT NAIRNDGYAP  180
AADLMDSKSV NERVANSGIL QSGLTRGFSA SVDPFSGNQG FRFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-66611366173NAC domain-containing protein 19
3swm_B8e-66611366173NAC domain-containing protein 19
3swm_C8e-66611366173NAC domain-containing protein 19
3swm_D8e-66611366173NAC domain-containing protein 19
3swp_A8e-66611366173NAC domain-containing protein 19
3swp_B8e-66611366173NAC domain-containing protein 19
3swp_C8e-66611366173NAC domain-containing protein 19
3swp_D8e-66611366173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098342.16e-84NAC domain-containing protein 72
SwissprotQ93VY31e-74NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A4D8YKK06e-82A0A4D8YKK0_SALSN; Uncharacterized protein
STRINGMigut.H01915.1.p5e-79(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Publications ? help Back to Top
  1. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  2. Li S, et al.
    The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence.
    Plant Cell Rep., 2016. 35(8): p. 1729-41
    [PMID:27154758]
  3. Ye H, et al.
    RD26 mediates crosstalk between drought and brassinosteroid signalling pathways.
    Nat Commun, 2017. 8: p. 14573
    [PMID:28233777]