PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100000360031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HD-ZIP
Protein Properties Length: 242aa    MW: 28121.3 Da    PI: 4.665
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100000360031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.5e-2070123356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k+++++++q++ Le++Fe ++++ ae++ +LAk+lgL+ rqV +WFqNrRa++k
  Ote100000360031|100000360031  70 KKRRLSHDQVHFLEKCFEVENKLEAERKIQLAKELGLQPRQVAIWFQNRRARYK 123
                                   56689************************************************9 PP

2HD-ZIP_I/II122.22.6e-3969160192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrls++qv++LE++Fe e+kLe erK +la+eLglqprqva+WFqnrRAR+ktk lEk+y +Lk++yd+lk + ++L 
  Ote100000360031|100000360031  69 EKKRRLSHDQVHFLEKCFEVENKLEAERKIQLAKELGLQPRQVAIWFQNRRARYKTKVLEKEYGSLKASYDKLKLDYDALV 149
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   ke+e++++e++
  Ote100000360031|100000360031 150 KEKENMKNEVN 160
                                   *******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-1962125IPR009057Homeodomain-like
PROSITE profilePS5007117.16765125IPR001356Homeobox domain
SMARTSM003891.1E-1868129IPR001356Homeobox domain
PfamPF000466.3E-1770123IPR001356Homeobox domain
CDDcd000864.45E-1670125No hitNo description
Gene3DG3DSA:1.10.10.605.7E-1972132IPR009057Homeodomain-like
PRINTSPR000314.6E-696105IPR000047Helix-turn-helix motif
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PRINTSPR000314.6E-6105121IPR000047Helix-turn-helix motif
PfamPF021836.1E-14125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MNDSRMANLL LKSESSEVLE SLWVPNSSPP FHASASMAQL EDENTSEKAF DTKPENCNEE  60
FDVCFHQAEK KRRLSHDQVH FLEKCFEVEN KLEAERKIQL AKELGLQPRQ VAIWFQNRRA  120
RYKTKVLEKE YGSLKASYDK LKLDYDALVK EKENMKNEVN LLTEKLATRE KKEKANSSEM  180
KQEEAVSWAK SDVLDSDTDG NNSDSCQEED GFPKLEMEDY LQPNSCNLGF PVQDQGTWFW  240
QY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071034.13e-98PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0V0I6667e-78A0A0V0I666_SOLCH; Putative ovule protein
STRINGSolyc05g006980.2.16e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495