PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g43950.2
Common NameLOC4352890, Os12g0636200, OsJ_36996, OSNPB_120636200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 648aa    MW: 72098.3 Da    PI: 6.1215
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g43950.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.8e-094074441954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  LOC_Os12g43950.2 407 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 444
                       665559******************************88 PP

2BELL121.63.4e-39270341172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       e+qelq+k akL+ +l+eVd++Yk+y++q+qtv+ssF++vag gsakpYt++Al++iSrhFrcLkdai +qi
  LOC_Os12g43950.2 270 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQTVVSSFDVVAGPGSAKPYTAVALQTISRHFRCLKDAINDQI 341
                       689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-58194339IPR006563POX domain
PfamPF075262.5E-51200337IPR006563POX domain
PROSITE profilePS5007112.325385448IPR001356Homeobox domain
SMARTSM003893.6E-9388452IPR001356Homeobox domain
CDDcd000865.43E-12388449No hitNo description
SuperFamilySSF466892.87E-17389454IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28391454IPR009057Homeodomain-like
PfamPF059201.0E-17405444IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MATYYSSPGS ERDSQTMYSR DPGSASYPMS SALGNLLYLN NPSSGPYTEF SGILQPQQNC  60
MEMPGPGHAS AMSQDPSSRE SDMLSSHQGQ RSFSHVKDMK NEMLMHMMDG AQGSGSELIH  120
DDAHTGSQLE FGVLNNHNSS SVPSMQSQGL SLSLNTQIMA PSLPYWSIKP DMLTPQSYHD  180
NLRGEDMRMK NLQSEASRAI RNSRYLKAAQ ELLDEVVSVW KSIKQKAQKE KVESGKADGK  240
ETDGGPKSEG VSSNPQESGA NAAPELSTAE KQELQNKMAK LMAMLDEVDR KYKHYYHQMQ  300
TVVSSFDVVA GPGSAKPYTA VALQTISRHF RCLKDAINDQ INVIRKKLGE EENSSGKEGK  360
LTRLRYIDQQ LRQQRAFQQY GMIPQNAWRP QRGLPENSVT ILRAWLFEHF LHPYPKDSEK  420
LMLARQTGLT RSQISNWFIN ARVRLWKPMI EDMYKEEIGD LEQDSNSSSD NAPRSKDKMA  480
SSEDKEDLKN SRARICETSQ LSESRTSIGA MNVGGAPVGF QNEPNPDDSF MNLMLKDQRS  540
NEVDGGLLLH NTVAQHSDEN ARFMAYHLAE LGRYGNGNVS LTLGLQHSSS NLVPNAQPGF  600
PGVNEDDIYN ATAPLGVTVA SSDYDSMNQM DQRQRFEHSP LLHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16394451158Homeobox protein Meis1
4xrs_B3e-16394451158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.64920.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329804890.0
Expression AtlasQ2QLM6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g43950.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g43950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704650.0AK070465.1 Oryza sativa Japonica Group cDNA clone:J023054P21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619822.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_015619823.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0E0RKG80.0A0A0E0RKG8_ORYRU; Uncharacterized protein
TrEMBLQ2QLM60.0Q2QLM6_ORYSJ; Associated with HOX family protein, expressed
STRINGLOC_Os12g43950.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-112BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]