PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g42970.1
Common NameLOC4352838, Os12g0624900, OsJ_36935, OSNPB_120624900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 310aa    MW: 34830.4 Da    PI: 7.6726
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g42970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.47e-17239273135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  LOC_Os12g42970.1 239 CTHCLSYKTPQWRTGPLGPKTLCNACGVRFKSGRL 273
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004010.0023154203IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-5154197No hitNo description
Gene3DG3DSA:3.30.50.101.3E-4158200IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.187233269IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-13233287IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-13237296No hitNo description
CDDcd002023.15E-12238295No hitNo description
Gene3DG3DSA:3.30.50.101.2E-12238271IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-14239273IPR000679Zinc finger, GATA-type
PROSITE patternPS003440239264IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDVHPPNAAA SSLEELFPHQ PATESDRSGI EWLSVYVEDC LSTSASCTNP VSAELPPITM  60
ASQGAAKPKL PPRSSTNARK KKRSLASVIS DTDDQHCITL FVEPPLLLLD HKDWLAESEL  120
ILPKKDKDEE LVQEQEQEEE ENYKMSAGMQ FQQEQLVITC SYCLSSQSPQ WWDGPSGPTC  180
DACRLRIEAR NGHTTSSKKR YGQEIDKEQD IGKRRDKKKI KKAVYVNDEL LSEEPMKRCT  240
HCLSYKTPQW RTGPLGPKTL CNACGVRFKS GRLLPEYRPA NSPTFVSDIH SNSHKKVMQL  300
RNSVPHPRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213221RRDKKKIKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.113820.0callus| flower| leaf| panicle| seed| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329866300.0
Expression AtlasQ2QLX6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g42970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g42970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470160.0EU847016.1 Oryza sativa Japonica Group clone KCS030C12 GATA zinc finger protein mRNA, complete cds.
GenBankAK1014210.0AK101421.1 Oryza sativa Japonica Group cDNA clone:J033038C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618342.10.0PREDICTED: uncharacterized protein LOC4352838
TrEMBLA0A0E0JCN70.0A0A0E0JCN7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RK950.0A0A0E0RK95_ORYRU; Uncharacterized protein
TrEMBLA2ZMY10.0A2ZMY1_ORYSI; Putative uncharacterized protein
TrEMBLI1R8130.0I1R813_ORYGL; Uncharacterized protein
TrEMBLQ2QLX60.0Q2QLX6_ORYSJ; GATA zinc finger family protein, expressed
STRINGBGIOSGA037833-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g42970.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0166900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-35GATA transcription factor 2
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]