PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g42610.1
Common NameLOC4352818, Os12g0621100, YAB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family YABBY
Protein Properties Length: 208aa    MW: 22777.8 Da    PI: 9.042
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g42610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY235.41.3e-7261775170
             YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee......lleelkveeenlksnvekees 91 
                         +eqvCyv+CnfCntilavsvP +s++++vtvrCGhCt+llsvnl+  ++  +a ++ +++  +e        ++ +  e  ++   ++++ 
  LOC_Os12g42610.1   6 APAEQVCYVHCNFCNTILAVSVPGNSMLNIVTVRCGHCTNLLSVNLRGLMHSAPALQDHHHHHLQEsglsgcFRDQSGYPEFGFSAASSSSKL 98 
                       5689**********************************************9999866544444444477776677777777777777777777 PP

             YABBY  92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                            ++ ++s +++++  ++    rPPekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWah+P+ihfgl
  LOC_Os12g42610.1  99 RLPPAAAAMVSYSQQNQQLEQALHARPPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 177
                       7777888888988888888777889****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.4E-747177IPR006780YABBY protein
SuperFamilySSF470953.01E-8122171IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.3E-5124171IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MSAQIAPAEQ VCYVHCNFCN TILAVSVPGN SMLNIVTVRC GHCTNLLSVN LRGLMHSAPA  60
LQDHHHHHLQ ESGLSGCFRD QSGYPEFGFS AASSSSKLRL PPAAAAMVSY SQQNQQLEQA  120
LHARPPEKRQ RVPSAYNRFI KEEIRRIKAN NPDISHREAF STAAKNWAHY PNIHFGLSPG  180
HEGGKKLVDV DPIPTAPSSK KIQGFYS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.95010.0callus| flower| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329807600.0
Expression AtlasQ2QM17-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:17216490}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g42610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g42610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9401950.0FJ940195.1 Oryza sativa Japonica Group clone KCS385G10 YABBY protein mRNA, complete cds.
GenBankCT8291390.0CT829139.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA051K22, full insert sequence.
GenBankAB2740180.0AB274018.1 Oryza sativa Japonica Group OsYABBY6 mRNA for OsYABBY6 protein, complete cds.
GenBankAK1049180.0AK104918.1 Oryza sativa Japonica Group cDNA clone:001-047-F07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618575.11e-155PREDICTED: protein YABBY 6
SwissprotQ2QM171e-157YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A0E0BVE41e-155A0A0E0BVE4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FE721e-155A0A0E0FE72_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G0X71e-155A0A0E0G0X7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RK591e-155A0A0E0RK59_ORYRU; Uncharacterized protein
TrEMBLB7EXC71e-155B7EXC7_ORYSJ; YABBY protein
TrEMBLB8BN251e-155B8BN25_ORYSI; Putative uncharacterized protein
TrEMBLI1R7Z41e-155I1R7Z4_ORYGL; Uncharacterized protein
STRINGBGIOSGA037817-PA1e-155(Oryza sativa Indica Group)
STRINGLOC_Os12g42610.11e-155(Oryza sativa Japonica Group)
STRINGORGLA12G0165000.11e-155(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22101236
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-59YABBY family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Toriba T, et al.
    Molecular characterization the YABBY gene family in Oryza sativa and expression analysis of OsYABBY1.
    Mol. Genet. Genomics, 2007. 277(5): p. 457-68
    [PMID:17216490]