PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g42400.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 206aa    MW: 22165.4 Da    PI: 9.0889
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g42400.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA44.64.6e-14150185137
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 
                       d+p+YVNaKQ+++I++RR++Rak+e+e++l  k+rk 
  LOC_Os12g42400.4 150 DAPIYVNAKQCSAIIRRRHARAKAERENRL-VKARKV 185
                       68****************************.888885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.7E-4148199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115214.28149184IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.4E-11152184IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MMSFNKSQEG FGQVAAVATL ASNGGGSLPW LLYGEPLGQG KPAMSPEGVV PRAQTPLDPP  60
QVPAMDRGVP EILNFSMVPG KGEKCSEHST TIALQSPFAE YNGCFELGLG QSVVPSNYPY  120
ADQHYGLLSP YGVRPTPSGR ILIPPNMPAD APIYVNAKQC SAIIRRRHAR AKAERENRLV  180
KARKVSLNFQ LSMDSFSFAI LYISL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.227070.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329837650.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g42400.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g42400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880320.0AB288032.1 Oryza sativa Japonica Group OsHAP2F mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0737420.0AK073742.1 Oryza sativa Japonica Group cDNA clone:J033067G24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618449.11e-133PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_015618450.11e-133PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA0A0E0RK431e-133A0A0E0RK43_ORYRU; Uncharacterized protein
TrEMBLB8BN181e-133B8BN18_ORYSI; Putative uncharacterized protein
TrEMBLQ2QM381e-133Q2QM38_ORYSJ; CCAAT-binding transcription factor subunit B family protein, expressed
STRINGBGIOSGA035818-PA1e-133(Oryza sativa Indica Group)
STRINGLOC_Os12g42400.11e-133(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-11nuclear factor Y, subunit A10