PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g42400.1
Common NameLOC4352811, Os12g0618600, OsHAP2F, OsJ_36895, OSNPB_120618600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 312aa    MW: 33663.2 Da    PI: 8.4791
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g42400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.82.4e-30150206158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d+p+YVNaKQ+++I++RR++Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  LOC_Os12g42400.1 150 DAPIYVNAKQCSAIIRRRHARAKAERENRL-VKARKPYLHESRHLHAMRRARGSGGRF 206
                       68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-33148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.128149209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-21152174IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-26152206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-21183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MMSFNKSQEG FGQVAAVATL ASNGGGSLPW LLYGEPLGQG KPAMSPEGVV PRAQTPLDPP  60
QVPAMDRGVP EILNFSMVPG KGEKCSEHST TIALQSPFAE YNGCFELGLG QSVVPSNYPY  120
ADQHYGLLSP YGVRPTPSGR ILIPPNMPAD APIYVNAKQC SAIIRRRHAR AKAERENRLV  180
KARKPYLHES RHLHAMRRAR GSGGRFLNTK KETNGKTTGG GRKVMDIIIP PLCPAASPSS  240
EQCNPSSVSS LSGSEVSSIY EHEDMDHFHS FDHLRTHFFT PLPSLMDVEH GAGNPFKWTA  300
ASDGCCDLLK A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-16150214266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A2e-16150207260HAPB protein
4g92_A2e-16150207260HAPB protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.227070.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329837650.0
Expression AtlasQ2QM38-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g42400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g42400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880320.0AB288032.1 Oryza sativa Japonica Group OsHAP2F mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0737420.0AK073742.1 Oryza sativa Japonica Group cDNA clone:J033067G24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618449.10.0PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_015618450.10.0PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA0A0E0RK430.0A0A0E0RK43_ORYRU; Uncharacterized protein
TrEMBLB8BN180.0B8BN18_ORYSI; Putative uncharacterized protein
TrEMBLQ2QM380.0Q2QM38_ORYSJ; CCAAT-binding transcription factor subunit B family protein, expressed
STRINGBGIOSGA035818-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g42400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP51361122
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.23e-26nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]