PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g41880.2
Common NameLOC4352778, NF-Y22, Os12g0613000, OsHAP2B, OsJ_36853, OSNPB_120613000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 218aa    MW: 23721.1 Da    PI: 9.5575
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g41880.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.87.7e-33108164158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq+Rak+e+ekkl  k+rkpylheSRh+hAl+R+Rg gGrF
  LOC_Os12g41880.2 108 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKPYLHESRHQHALKRARGAGGRF 164
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.7E-35106167IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.332107167IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-27109164IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23110132IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860112132IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23141164IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MTSVVHDVSG NHGADERQKQ QRQGEPEDQQ EASVTSTDSH TMVATPSTDY ATPYAHHDMA  60
HAMGQIAYAN IDPYYGSLYA AYGGQPMMHP PLVGMHPAGL PLPTDAIEEP VYVNAKQYNA  120
ILRRRQSRAK AESEKKLVKG RKPYLHESRH QHALKRARGA GGRFLNSKSD DKEEHSDSSS  180
RDKQDGVAPR DSGQPSTSPS SKGASSAKQN KKSKTSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-22107171165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.56020.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QM93
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g41880.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g41880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8396730.0HQ839673.1 Oryza sativa Japonica Group NF-Y transcription factor 22 (NF-Y22) mRNA, complete cds.
GenBankAB2880280.0AB288028.1 Oryza sativa Japonica Group OsHAP2B mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0651630.0AK065163.1 Oryza sativa Japonica Group cDNA clone:J013002C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618405.11e-160PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2
TrEMBLA0A0E0JCD41e-160A0A0E0JCD4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RJY21e-160A0A0E0RJY2_ORYRU; Uncharacterized protein
TrEMBLA2ZMP11e-160A2ZMP1_ORYSI; Putative uncharacterized protein
TrEMBLI1R7T41e-160I1R7T4_ORYGL; Uncharacterized protein
TrEMBLQ2QM931e-160Q2QM93_ORYSJ; CCAAT-box transcription factor complex WHAP5, putative, expressed
STRINGBGIOSGA035844-PA1e-159(Oryza sativa Indica Group)
STRINGLOC_Os12g41880.21e-159(Oryza sativa Japonica Group)
STRINGORGLA12G0159000.11e-159(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.25e-44nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]