PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g41880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 155aa    MW: 17057 Da    PI: 6.7255
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g41880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA53.39.4e-17109144137
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 
                       +ep+YVNaKQy++Il+RRq+Rak+e+ekkl  k+rk 
  LOC_Os12g41880.1 109 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKV 144
                       69****************************.999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.5E-7107153IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115218.084108154IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.6E-12110144IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860113133IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MTSVVHDVSG NHGADERQKQ QRQGEPEDQQ EASVTSTDSH TMVATPSTDY ATPYAHHDMA  60
HAMQGQIAYA NIDPYYGSLY AAYGGQPMMH PPLVGMHPAG LPLPTDAIEE PVYVNAKQYN  120
AILRRRQSRA KAESEKKLVK GRKVNLISTF YETI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.56020.0callus| leaf| panicle| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g41880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g41880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8346790.0CT834679.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN051A15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618406.11e-105PREDICTED: nuclear transcription factor Y subunit A-7 isoform X3
TrEMBLA0A0E0FEF51e-103A0A0E0FEF5_9ORYZ; Uncharacterized protein
TrEMBLQ2QM941e-103Q2QM94_ORYSJ; CCAAT-box transcription factor complex WHAP5, putative, expressed
STRINGBGIOSGA035844-PA1e-100(Oryza sativa Indica Group)
STRINGLOC_Os12g41880.21e-100(Oryza sativa Japonica Group)
STRINGORGLA12G0159000.11e-100(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-27nuclear factor Y, subunit A7