PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g41680.1
Common NameLOC4352763, Os12g0610600, OsJ_36832, OSNPB_120610600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 334aa    MW: 36341.2 Da    PI: 8.9766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g41680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52141421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp+ ++ + kewyfFs rd+kyatg+r+nrat sgyWkatgkd+ 
  LOC_Os12g41680.1  14 LPPGFRFHPRDDELICDYLAPKVAGKVgFSGRRPpMVDVDLNKVEPWDLPEVASVGGKEWYFFSLRDRKYATGQRTNRATVSGYWKATGKDRV 106
                       79************************986665656***************8888899***********************************9 PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v + +g+lvg++ktLvfy+grapkg+kt+Wvmheyr+
  LOC_Os12g41680.1 107 VAR-RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRM 142
                       999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-592167IPR003441NAC domain
PROSITE profilePS5100555.82214167IPR003441NAC domain
PfamPF023652.2E-2715142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSMMSFLSMV EAELPPGFRF HPRDDELICD YLAPKVAGKV GFSGRRPPMV DVDLNKVEPW  60
DLPEVASVGG KEWYFFSLRD RKYATGQRTN RATVSGYWKA TGKDRVVARR GALVGMRKTL  120
VFYQGRAPKG RKTEWVMHEY RMEGVHDQQA SSFSSKEDWV LCRVICKRKS GGGATSKSRS  180
LTTTTTTIVH DTSTPTSSPP LPPLMDTTLA QLQASMNTSS SSAIAAVAAL EQVPCFSSFS  240
NSIASNNNNS NSATVNAQQC YLPIVTGSNN NGMSYLDHGL PEFGSFLDTQ SCDKKMLKAV  300
LSQLNSIGGE VLPGLPPPSE MAAAVSSSWM NHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-511016811169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.532280.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329814870.0
Expression AtlasQ2QMB5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g41680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g41680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0714640.0AK071464.1 Oryza sativa Japonica Group cDNA clone:J023097O13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620576.10.0PREDICTED: NAC domain-containing protein 21/22 isoform X2
SwissprotQ84TE67e-90NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLQ2QMB50.0Q2QMB5_ORYSJ; Os12g0610600 protein
STRINGLOC_Os12g41680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1464544
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-79NAC domain containing protein 1
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]