PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g41230.3
Common NameLOC4352740, Os12g0605500, OSNPB_120605500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 761aa    MW: 82024.8 Da    PI: 6.99
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g41230.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.67.9e-16455494241
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                       ++k+C+CkkskClk+YCeCf+ag++Cse C+C++C N  +
  LOC_Os12g41230.3 455 SCKRCSCKKSKCLKLYCECFHAGVFCSEPCSCQGCLNMPS 494
                       689**********************************865 PP

2TCR50.73.4e-16539577139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  LOC_Os12g41230.3 539 RHKRGCNCKKSSCLKKYCECYQGGVGCSVSCRCEGCKNA 577
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.5E-16454495IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.454455579IPR005172CRC domain
PfamPF036384.4E-12457492IPR005172CRC domain
SMARTSM011144.5E-17539580IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11541577IPR005172CRC domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 761 aa     Download sequence    Send to blast
MDTPDRPPRA AATAAVEDSP VFNFINSLSP IPPPKPSDSA HNVQLFKSSD LAPVSSIFAS  60
PHVNPAKESK LPIREDSVQL SRESHSPNSV RTRTGATSSI IRMIRCKNIV SENCSITCYL  120
NDSTSSKASQ PIQLCGGSAE SDTNQNTDGK KDPTTEQDRT DIEFVLLDQC GPEKMDSSQS  180
GNNACENQLS EQHKDELGSF DGGYMFAHQP HSDMLRLAPP FESETQLVNE TLQTDNVYCE  240
TLLTDGPSGS YTQNSAPDPH LYWAGAVEGC ATDYTPQMLP GACQSQLVPN DQINNKLNEP  300
SDYMPMDHNV SSQNLRGMRR RCLFNEKSGA ANEGAKNSSA RHSTNSTTPR RKISSSDNNL  360
KTLRTPPCAL PGIGLHLNAL ATVPKDKMVP HNDIQSSLNQ ASNVPSAVGS SPPTDDPHTI  420
NDDSSQTAVV AYVGESSQGS PKKKRHKFDN GDGTSCKRCS CKKSKCLKLY CECFHAGVFC  480
SEPCSCQGCL NMPSNMETVL STREQIESRN PLAFAPKVIR TEPGQELADD SNKTPASSRH  540
KRGCNCKKSS CLKKYCECYQ GGVGCSVSCR CEGCKNAFGR REGVALLGIE EAKRGCEEKD  600
GGVKEETTDN DKQLVIYQDS INLTPAESVL ATPSVVDYRP LVALPPLSSK KPRSSTKLGG  660
YSSRLEGHLK SDILLSPFES YAEMMLGDGT SNVLKGESSP QTSVKVVSPN KKRVSPPRIG  720
TGLSPICKSG RKLILKSIPS FPSLGVDITN EDPNTSSLAP *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.185790.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329839650.0
Expression AtlasQ2QMG6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g41230.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g41230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0739420.0AK073942.1 Oryza sativa Japonica Group cDNA clone:J033075J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620275.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLQ2QMG60.0Q2QMG6_ORYSJ; Os12g0605500 protein
STRINGLOC_Os12g41230.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-74Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]