PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g41210.1
Common NameLOC4352738, Os12g0605300, OSNPB_120605300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 408aa    MW: 44429.5 Da    PI: 6.4931
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g41210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.85.2e-14100137340
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C+CkkskClk+YC Cfa+g++Cse+C C+ C Nk+
  LOC_Os12g41210.1 100 CKSCSCKKSKCLKLYCVCFASGSHCSESCGCDPCYNKS 137
                       89**********************************97 PP

2TCR46.38.4e-15176211439
               TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++C+Ckks ClkkYC+C++ g+ Cs +CkC+dCkN 
  LOC_Os12g41210.1 176 RKCTCKKSGCLKKYCDCYQGGAGCSINCKCDDCKNP 211
                       79*********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014473.66E-54050No hitNo description
SMARTSM011144.5E-998139IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163428.85499213IPR005172CRC domain
PfamPF036389.5E-10101136IPR005172CRC domain
SMARTSM011147.8E-13173214IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.7E-11176210IPR005172CRC domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSAAEDPAKP PPPPPPQLEA SGSDPDDPLL RDRVVVIAPP PPPPPPPPPP APAPALLAPA  60
ENASAEAAFA VPPAAIAAVV EANGNSEKKK KRKTDEGEGC KSCSCKKSKC LKLYCVCFAS  120
GSHCSESCGC DPCYNKSIHG VPRSTPALPL KAVQTLETGQ DSVEQLIRSP MDFGRRKCTC  180
KKSGCLKKYC DCYQGGAGCS INCKCDDCKN PYGRKVGVIL DGKNILAGPT PNERNGTEAD  240
SSDDEEDDYY MNRPLSPVSP SPVSRESSFQ QETLVGVEVQ TMNGHLYPKP LTQVRPESWQ  300
LTRRPTEEVR GEAWHYLRRP SEDGTSDVME GHADPKFQRD NKQLENHVDR YSIPRCIEVM  360
NAMADLSPIE KSLAPDVFLD PSNREIFLSL TVDIRTMWLK RKMKSLV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18792KKKKRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154894710.0
Expression AtlasQ2QMG8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g41210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g41210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067180.0CU406718.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103K09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618281.10.0PREDICTED: protein lin-54
TrEMBLI1R7P40.0I1R7P4_ORYGL; Uncharacterized protein
TrEMBLQ2QMG80.0Q2QMG8_ORYSJ; Os12g0605300 protein
STRINGLOC_Os12g41210.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0155000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1307345
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-25TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]