PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g40090.1
Common NameOs12g0591500, OsJ_36712
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 335aa    MW: 37960.1 Da    PI: 8.8811
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g40090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.53.2e-1518941494
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                B3 14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                      + +++p k ae ++g+ ++     l+++sg++W+v +   k  ++ +l++GW++F+ka++L+e+D + F+ +g+ ++++ +
  LOC_Os12g40090.1 18 HGISIPEKVAEIFSGQITK--GFNLKSPSGETWRVGV--AKVADELILKSGWEDFAKAHELQENDLLFFTCNGHGNGSCSF 94
                      459*******777777555..59999***********..*******************************77665554443 PP

2B348.61.5e-15227324198
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgr.sef 90 
                       f+ vl +++v ++++l++p +fa++h +   +s ++ l    + ++W+vk+ y +++ +++     W +F ++n+L+eg +++F+l++  ++ 
  LOC_Os12g40090.1 227 FVVVLQTAHVRRRNILIVPTRFAADHLER--KSHDILLIRpNRKQKWSVKYYYlSNTTRGFNCH-RWIKFIRENRLREGNVCIFELMKGaRRP 316
                       788999********************544..45567776636779******8865555555544.8*******************99776888 PP

                       ..EEEEE- CS
                B3  91 elvvkvfr 98 
                       +++v+v+ 
  LOC_Os12g40090.1 317 TMTVHVIG 324
                       99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-183104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.0695102IPR003340B3 DNA binding domain
CDDcd100173.03E-147100No hitNo description
SMARTSM010191.4E-68102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.9E-188104IPR015300DNA-binding pseudobarrel domain
PfamPF023621.6E-121792IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.8E-18220324IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-21221322IPR015300DNA-binding pseudobarrel domain
CDDcd100171.57E-18225321No hitNo description
SMARTSM010197.9E-10227326IPR003340B3 DNA binding domain
PROSITE profilePS5086313.225227326IPR003340B3 DNA binding domain
PfamPF023622.5E-13227324IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDVSRIRFFR LMTGDFAHGI SIPEKVAEIF SGQITKGFNL KSPSGETWRV GVAKVADELI  60
LKSGWEDFAK AHELQENDLL FFTCNGHGNG SCSFDVLIFD ASGCEKVSCF FTGKKNSYMC  120
KNFNSIGGQV AGQYLSSDSE DTSTPSVLIG SPHKASTSKK LSGKTKTNPR KEPEDPNCSH  180
WHVIEEKNTD DDEHADYHYT RFANYLTGEE RDEIFSLVSL QPGNPVFVVV LQTAHVRRRN  240
ILIVPTRFAA DHLERKSHDI LLIRPNRKQK WSVKYYYLSN TTRGFNCHRW IKFIRENRLR  300
EGNVCIFELM KGARRPTMTV HVIGKADNRF VLLG*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QMT5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g40090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g40090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9548290.0AL954829.6 Oryza sativa chromosome 12, . BAC OSJNBa0044E20 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619308.10.0PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein LOC_Os12g40090-like
SwissprotQ2QMT50.0Y1209_ORYSJ; B3 domain-containing protein LOC_Os12g40090
TrEMBLA0A0D3HWA30.0A0A0D3HWA3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GVZ80.0A0A0E0GVZ8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RJF40.0A0A0E0RJF4_ORYRU; Uncharacterized protein
TrEMBLA2ZM930.0A2ZM93_ORYSI; Putative uncharacterized protein
TrEMBLI1R7J70.0I1R7J7_ORYGL; Uncharacterized protein
STRINGLOC_Os12g40090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6299819
MonocotsOGMP56234179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-23B3 family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]