PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g39990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 266aa    MW: 26597.4 Da    PI: 9.6173
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g39990.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.76.8e-3551105660
            zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  LOC_Os12g39990.1  51 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 105
                       68**************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2151102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.51251105IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3051103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEAPLHQSPV PLLPPPPPPP RVVGVQQQQQ QEAVVPPPPA MAAAAGGGGR EQCPRCASRD  60
TKFCYYNNYN TAQPRHFCRA CRRYWTLGGS LRNVPIGGST RKRPRPSRPA RAAVAAAIAA  120
AAAASASGSQ IAAQQQQAPP VVMSQHEAAA AAAAASGGGG GDGLLVSLLG AAPVLEGRLG  180
GGIGVDLLGG EQLGFGAMAM PPAPLLWPAR VLEGGDAWKS AAAAAGVSYS PFPALWQELA  240
AAAPVELAGG GGLLRHGGGG APQLM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101105KRPRP
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379894263e-80
Expression AtlasQ2QMU5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g39990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g39990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9548290.0AL954829.6 Oryza sativa chromosome 12, . BAC OSJNBa0044E20 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661525.11e-42PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A0E0RJF00.0A0A0E0RJF0_ORYRU; Uncharacterized protein
TrEMBLQ2QMU50.0Q2QMU5_ORYSJ; Dof domain, zinc finger family protein
STRINGLOC_Os12g39990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-25DOF zinc finger protein 1
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]