PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g39640.1
Common NameLOC4352661, Os12g0586300, OSNPB_120586300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 396aa    MW: 41463.3 Da    PI: 8.2426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g39640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.3e-32247302156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFv a+++LGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  LOC_Os12g39640.1 247 KARRCWSPELHRRFVAALQRLGGPQAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 302
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.583244304IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-29245305IPR009057Homeodomain-like
SuperFamilySSF466892.69E-17245305IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26247302IPR006447Myb domain, plants
PfamPF002493.3E-7249300IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGSSSASAAQ HEEAAAAAAF VLGGVDMRML AARTATGALA RAGGGEAAAA AAAAARFEDC  60
IRSLEAEKAK MEVFRRELPI SVHLIADVIE WLKDEVEKQR LLRRRQVEAP AAAPPPEMFA  120
PPATAKRKSA ASAAAEGVKA EADANDKRSW MSSAQLWSCG SHTSTSTSNG GSVKKQQHKV  180
SNAFMPLATL PAFAKSLEKA DAAVPDLSLS SRVAMADAPA CPAAPSATSS AVTDVAVAQR  240
QQAVQRKARR CWSPELHRRF VAALQRLGGP QAATPKQIRE LMKVDGLTND EVKSHLQKYR  300
LHTRRASDGG DGGGDHQTVG GRLWPLPPEQ YTTSQHSTSQ SGSPQGPLQL TVSSSHAVSV  360
TAGDSCDGGE EEEEDGKSGS YSWEMQNGAR ASSSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.889930.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154893370.0
Expression AtlasQ2QMY1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g39640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g39640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149681e-168AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448801e-168AL844880.3 Oryza sativa chromosome 12, . BAC OSJNBb0049H14 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618787.10.0PREDICTED: uncharacterized protein LOC4352661
TrEMBLQ2QMY10.0Q2QMY1_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os12g39640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-30G2-like family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]