PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g38490.1
Common NameLOC4352595, Os12g0573200, OsJ_36602, OSNPB_120573200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 739aa    MW: 81365 Da    PI: 4.9526
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g38490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.62.2e-1103587301374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k+
  LOC_Os12g38490.1 358 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKKV 447
                       6789***************************************************999999999999998...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++a 
  LOC_Os12g38490.1 448 SFIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIAAV 540
                       ***********************************************************9*****************************9999 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ pr
  LOC_Os12g38490.1 541 KMESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPR 633
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       ese+r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++
  LOC_Os12g38490.1 634 ESEQRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAI 726
                       ********************************************************************889********************** PP

              GRAS 371 SaWr 374
                       S W+
  LOC_Os12g38490.1 727 STWT 730
                       ***5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.733332710IPR005202Transcription factor GRAS
PfamPF035147.8E-108358730IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MGSSAADSFP ACGDDAIRDV YGIGGGGEED DPSLFLYLSD LAPVSPSAYL DLPPSPPPPT  60
TTATTMVKEG EEAPEDLVLP FISRMLMEED IDDKFFYDYP DNPALLQAQQ PFLEILSDPS  120
SNSRSSNSDD PRLSPTSSSD TSAAINSYDA AATATAVAAA AVPVPQYESI ELDPAAFFAA  180
ANSDLMSSAF LKGMEEANKF LPTENKLIID LEASSENNYL RGLEEAKRFL PSDDKLQVGF  240
AAAAAPVVSV KKEAVDVVVA TASGGGGRGR KNPYDDEELE LEGGRSSKQT AVQGDDVAAR  300
AMFDKVMMPS HENCTEMMEK LRIAMKEEAA KNEASAGGKG GNGKVKGGRR GGRDVVDLRT  360
LLIHCAQAVA TDDRRSATEL LKQIKQHAKP TGDATQRLAH CFAEGLQARI AGTGSLVHQS  420
LVAKRTSAVD ILQAYQLYMA AICFKKVSFI FSNQTIYNAS LGKKKIHIVD YGIQYGFQWP  480
CFLRRISQRE GGPPEVRMTG IDLPQPGFRP TERIEETGHR LSKYAQEFGV PFKYNAIAAV  540
KMESVRKEDL NIDPDEVLIV NCQYQFKNLM DESVVIDSPR DIVLSNIRKM QPHVFIHAIV  600
NGSFSAPFFV TRFREALFFY SALFDVLDAT TPRESEQRLL IEQNIFGRAA LNVIACEGID  660
RVERPETYKQ WQVRNQRAGF KQLPLNPEIV QVVRNKVKDC YHKDFVIDID HQWLLQGWKG  720
RILYAISTWT PNDALSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-443627298374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.142500.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379915660.0
Expression AtlasQ2QNA3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g38490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g38490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLQ2QNA30.0Q2QNA3_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-165GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]