PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g38400.2
Common NameLOC4352588, Os12g0572000, RS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 343aa    MW: 39041.6 Da    PI: 10.2778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g38400.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-15958148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                      r+rW +eEd +l+ +v+q+G++ W++++++m+  ++R +k+c +rw +yl
  LOC_Os12g38400.2  9 RQRWRPEEDAILLAYVRQYGPREWSLVSQRMNrpLHRDAKSCLERWKNYL 58
                      89**********************************************97 PP

2Myb_DNA-binding34.16.5e-1164108147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  LOC_Os12g38400.2  64 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 108
                       57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.683158IPR017930Myb domain
SMARTSM007171.7E-13860IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-209103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-201165IPR009057Homeodomain-like
CDDcd001671.51E-71158No hitNo description
PfamPF139216.3E-141273No hitNo description
PROSITE profilePS5129422.39159113IPR017930Myb domain
SMARTSM007171.4E-963111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-1566107IPR009057Homeodomain-like
CDDcd001671.76E-568109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MQPPPMRERQ RWRPEEDAIL LAYVRQYGPR EWSLVSQRMN RPLHRDAKSC LERWKNYLRP  60
GIKKGSLTDD EQRLVIRLQA KHGNKWKKIA AEVPGRTAKR LGKWWEVFKE KQQRELRDRD  120
RRRLPPPLDG DERGCAGGRY DWLLEDFADK LVNDHHRRMM AAPILPPWMS SSPSSSSSPS  180
VTLSLASAAV APAPAAPPPT WGGGGGGEVV VAELMECCRE MEEGQRAWAA HRKEAAWRMK  240
RVEMQLETER ACRRREATEE FEAKMRALRE EQAAAVERVE AEYREKMAGL RRDAEAKEQK  300
MAEQWAAKHA RLAKFLDQVA ACRRWPPVEI NGGGGGGPGG GR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-1512106798MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-1512106798C-Myb DNA-Binding Domain
1msf_C1e-1512106798C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.808680.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ94IB1
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. May interact with other proteins to repress the knox homeobox genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g38400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g38400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0645190.0AB064519.1 Oryza sativa Japonica Group OsRS2 mRNA for transcription factor rough sheath 2 like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620377.10.0PREDICTED: protein rough sheath 2 homolog
RefseqXP_015620378.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotQ94IB10.0RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLF4MGP40.0F4MGP4_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os12g38400.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP50961421
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-88MYB family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]