PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g38200.1
Common NameLOC4352574, Os12g0569900, OSNPB_120569900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 349aa    MW: 35336.3 Da    PI: 8.8926
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g38200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37e-3893150562
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  LOC_Os12g38200.1  93 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 150
                       679***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3275148IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3194148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38594148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVFSSLPIFL DPPNWTQMQQ QPLQCLIGGG GSDHHHLMPP PSGLAPLPSA AGAADTAASA  60
PAAAAQQQQP RPAVVSMSER ARLARVPLPE PGTLRCPRCD STNTKFCYFN NYSLSQPRHF  120
CKACRRYWTR GGALRNVPVG GGCRRNTKRS TKKSSSSSSR QGGGAGNAAA AATSSSSTTS  180
TSTTATTSSA AAAAAAAAAD VIASMQAGGA LLPHHLIGGL PSSAAAAAAL EASLEGYHHH  240
HHAHGHQLPF LQPPPFLQQG LHGYHFADGD VAAGAALADG GFPRGVASGL LAQLASVKME  300
EHGTNNGGGV GGGFVGAHEQ YWHGGNGGGG WPAEFLSGFS SSSSGNVL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.796830.0leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QND3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g38200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g38200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2883490.0AK288349.1 Oryza sativa Japonica Group cDNA, clone: J090023P19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619417.10.0PREDICTED: dof zinc finger protein DOF5.1
TrEMBLQ2QND30.0Q2QND3_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os12g38200.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-40Dof family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]