PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g37970.2
Common NameLOC4352559, MYB17, MYBAS2, Os12g0567300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 178aa    MW: 20118.8 Da    PI: 6.0093
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g37970.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-16243548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      ++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os12g37970.2  2 SPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43
                      899***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.01E-12143No hitNo description
SMARTSM007173.8E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129423.752147IPR017930Myb domain
PfamPF002494.0E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-19244IPR009057Homeodomain-like
SuperFamilySSF466891.56E-12249IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSPHEERLIL ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER KSNMSPSSSS  60
SSLTYQSCHP ETPSMIIGIE EQELHGGSGC ITSIMKSTPV DMDGYPMDQI WMEIEAPNVL  120
PGPCFDEAKD SASNSLSGPL LPYPMWDYYC PETCLRMDDE IKVAPQFGYG KGVGPCY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.116380.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924230.0
Expression AtlasQ4JL76-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g37970.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g37970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752630.0DQ075263.2 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-3 mRNA, complete cds, alternatively spliced.
GenBankDQ0752620.0DQ075262.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-2 mRNA, complete cds, alternatively spliced.
GenBankDQ0752610.0DQ075261.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-1 mRNA, complete cds, alternatively spliced.
GenBankAJ4957850.0AJ495785.1 Oryza sativa Japonica Group mRNA for MYB17 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620226.11e-131PREDICTED: myb-related protein MYBAS2 isoform X1
RefseqXP_015620229.11e-131PREDICTED: myb-related protein MYBAS2 isoform X1
SwissprotQ4JL761e-132MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA2ZLS51e-131A2ZLS5_ORYSI; Putative uncharacterized protein
TrEMBLF4MGP31e-131F4MGP3_ORYSJ; Myb family transcription factor, putative, expressed
STRINGBGIOSGA035986-PA1e-130(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-28myb domain protein 48
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]