PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g37970.1
Common NameOsJ_36546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 243aa    MW: 27843.8 Da    PI: 8.204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g37970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.9e-181057148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  LOC_Os12g37970.1 10 KGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                      79********************************************97 PP

2Myb_DNA-binding54.72.3e-1763108148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os12g37970.1  63 RGRMSPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.223561IPR017930Myb domain
SuperFamilySSF466892.58E-298104IPR009057Homeodomain-like
SMARTSM007171.9E-15959IPR001005SANT/Myb domain
PfamPF002491.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-191164IPR009057Homeodomain-like
CDDcd001671.39E-111257No hitNo description
PROSITE profilePS5129421.40162112IPR017930Myb domain
SMARTSM007172.2E-1662110IPR001005SANT/Myb domain
PfamPF002494.4E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2465111IPR009057Homeodomain-like
CDDcd001676.63E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVTVREEIRK GPWTEQEDLQ LVCTVRLFGE RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGRMSPHE ERLILELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKSNMS  120
PSSSSSSLTY QSCHPETPSM IIGIEEQELH GGSGCITSIM KSTPVDMDGY PMDQIWMEIE  180
APNVLPGPCF DEAKDSASNS LSGPLLPYPM WDYYCPETCL RMDDEIKVAP QFGYGKGVGP  240
CY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2871121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.116380.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924230.0
Expression AtlasA3CIJ4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g37970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g37970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752630.0DQ075263.2 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS2-3 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620227.10.0PREDICTED: myb-related protein MYBAS2 isoform X2
SwissprotQ4JL760.0MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA3CIJ40.0A3CIJ4_ORYSJ; Uncharacterized protein
STRINGLOC_Os12g37970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.34e-70myb domain protein 59