PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g37690.1
Common NameLOC4352537, OsJ_36524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 301aa    MW: 33864.5 Da    PI: 5.3717
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g37690.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-1759106148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+WT +Ed+ lv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  LOC_Os12g37690.1  59 RGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYL 106
                       89********************************************97 PP

2Myb_DNA-binding55.61.2e-17112155146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os12g37690.1 112 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 155
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.44854106IPR017930Myb domain
SuperFamilySSF466892.55E-3057153IPR009057Homeodomain-like
SMARTSM007171.3E-1458108IPR001005SANT/Myb domain
PfamPF002498.8E-1659106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2260113IPR009057Homeodomain-like
CDDcd001676.67E-1161106No hitNo description
PROSITE profilePS5129423.86107161IPR017930Myb domain
SMARTSM007171.2E-15111159IPR001005SANT/Myb domain
PfamPF002494.4E-16112155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-24114160IPR009057Homeodomain-like
CDDcd001671.09E-11114155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAASQRSRST AAQLDVDDQA AADQLMTMMR RPAAVLQDEA AAEEEASAAA ADLQLELRRG  60
PWTVDEDLTL VNYIADHGEG RWNSLARAAG LKRTGKSCRL RWLNYLRPDV KRGNFTADEQ  120
LLILDLHSRW GNRWSKIAQH LPGRTDNEIK NYWRTRVQKH AKQLNCDANS ARFKDAMRYL  180
WMPRLADASQ LGDHHGYNST TAMGDAHGMP VMTSSSSDSF ATSESYDGGL YANVQDNEMV  240
NGGDYWMQGA NKGFCSNYES EQLHPHEHSQ FQDPDLVGWV QGFSEGISEN FWSLEDIWKM  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-265315321120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.999000.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329824260.0
Expression AtlasQ2QNI6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g37690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g37690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4061840.0CU406184.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C108M20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618854.10.0PREDICTED: transcription factor MYB24
TrEMBLA0A0E0RIT40.0A0A0E0RIT4_ORYRU; Uncharacterized protein
TrEMBLQ2QNI60.0Q2QNI6_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os12g37690.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.18e-75myb domain protein 112
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]