PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g33070.1
Common NameLOC9272333, Os12g0515300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 410aa    MW: 43722.4 Da    PI: 6.8241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g33070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-153683148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw +yl
  LOC_Os12g33070.1 36 KGLWSPEEDEKLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRWINYL 83
                      678*******************************************97 PP

2Myb_DNA-binding51.52.3e-1689132146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E++l+v++++ lG++ W+ Ia++++ gRt++++k++w++
  LOC_Os12g33070.1  89 RGAFSPQEEDLIVNLHAILGNR-WSQIAARLP-GRTDNEIKNFWNS 132
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3143183IPR017930Myb domain
SuperFamilySSF466891.76E-2834130IPR009057Homeodomain-like
SMARTSM007178.7E-113585IPR001005SANT/Myb domain
PfamPF002492.9E-133683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-223790IPR009057Homeodomain-like
CDDcd001673.63E-93983No hitNo description
PROSITE profilePS5129424.97184138IPR017930Myb domain
SMARTSM007171.3E-1588136IPR001005SANT/Myb domain
PfamPF002497.4E-1589132IPR001005SANT/Myb domain
CDDcd001673.71E-1191131No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2591138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MRKPDCGGGG GAAKGGGVLG VAGGNNAAVV GGKVRKGLWS PEEDEKLVAY MLRSGQGSWS  60
DVARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEDLI VNLHAILGNR WSQIAARLPG  120
RTDNEIKNFW NSTIKKRLKI SSSSASPATT TDCASPPEHK LGAVVDLAGG GGATDDVVVG  180
TANAAMKSMW VDSSSSSSSS SSSMQSRPSI MAAAAAGRSY GGLLPLPDQV CGVDTSPPPP  240
FFHDHSISIK QAYYGSTGAH HHHHAIATMD GSSLIGDHHH HSSSILFGGA SVPPLLDHQT  300
ILDDDDDHPN KTGSNTTAAT LSSNITDNSN SNKNNSDNNN NISSSCCISL MNSSSNMIYW  360
EGHHQQQQQQ HQMLQQQQQH MSRNVMGEWD LEELMKDVSS LPFLDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28361387108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QPW4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g33070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g33070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340840.0JN634084.1 Oryza sativa Japonica Group secondary wall MYB46 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619488.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0E0RHX30.0A0A0E0RHX3_ORYRU; Uncharacterized protein
TrEMBLQ2QPW40.0Q2QPW4_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os12g33070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP98213545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-64myb domain protein 46
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]