PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g32250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 541aa    MW: 57760.2 Da    PI: 7.4023
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g32250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31270326259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkve+++ d+++ ei+Y+g+Hnh+
  LOC_Os12g32250.1 270 DDGYNWRKYGQKVVKGSDCPRSYYKCTHPNCPVKKKVEHAE-DGQISEIIYKGKHNHQ 326
                       8**************************************99.***************8 PP

2WRKY1079.7e-34426484159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe
  LOC_Os12g32250.1 426 LDDGYRWRKYGQKVVKGNPHPRSYYKCTYAGCNVRKHIERASSDPKAVITTYEGKHNHE 484
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-28266328IPR003657WRKY domain
SuperFamilySSF1182902.88E-25268328IPR003657WRKY domain
SMARTSM007742.5E-34269327IPR003657WRKY domain
PfamPF031061.6E-24270326IPR003657WRKY domain
PROSITE profilePS5081123.192270328IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-36412486IPR003657WRKY domain
SuperFamilySSF1182902.62E-29418486IPR003657WRKY domain
PROSITE profilePS5081137.413421486IPR003657WRKY domain
SMARTSM007741.1E-39426485IPR003657WRKY domain
PfamPF031064.2E-26427484IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MSARPPPPPR PRLALPPRSA AESLFTGAGD ASPGPLTLAS ALFPSDPDGG GGGGGVMTSS  60
SSSAAGATSF TQLLIGNLSA PPPPPPPPQQ QQQREAARGG GVARAGPALS VAPPPTAGSV  120
FTVPPGLSPS GLLDSPGLLF SPAMFDAFDV LDMFIPDKIL PKRATRIKLD IYFVKTSPEG  180
GFGMSHREAL AQVTAQASHS PLRMFDHTEQ PSFSAAPTSS EAMQHMNAAV NMTGISDMVM  240
GPTNNENVAF QPAEASQRYQ VNAPVDKPAD DGYNWRKYGQ KVVKGSDCPR SYYKCTHPNC  300
PVKKKVEHAE DGQISEIIYK GKHNHQRPPN KRAKDGSSSA ADQNEQSNDT VSGLSGIKRD  360
QEAIYGMSEQ LSGLSEGDDM DDGESRPHEA DDKESDSKKR NIQISSQRTS AEAKIIVQTT  420
SEVDLLDDGY RWRKYGQKVV KGNPHPRSYY KCTYAGCNVR KHIERASSDP KAVITTYEGK  480
HNHEPPVGRG NNQNAGNAAP SSSAQQNMQN LSSNQASLTM ADFNNINQRP IGVLQFKSEE  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-38260486877Probable WRKY transcription factor 4
2lex_A2e-38260486877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.177590.0flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QQ47
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g32250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g32250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL7317590.0AL731759.2 Oryza sativa chromosome 12, . BAC OSJNBa0009K11 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620542.10.0PREDICTED: probable WRKY transcription factor 3
TrEMBLQ2QQ470.0Q2QQ47_ORYSJ; WRKY DNA binding domain containing protein, expressed
STRINGLOC_Os12g32250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-105WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]