PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g31748.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 27741.7 Da    PI: 8.2234
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g31748.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.52e-241059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rien+  rqvtfskRr g+lKKA+E+ vLCd++va i+fs +g+l+ y+s
  LOC_Os12g31748.2 10 RIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYAS 59
                      8**********************************************986 PP

2K-box77.43.7e-269317716100
             K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       s++ ++ kL+ +ie L+++qR+l+G++L+sL+l+++qqLe+q+++sl++iRs+Kn+lll++i el++kek l e+n+ L+kk+ e
  LOC_Os12g31748.2  93 SMSYDHIKLRGRIEALKKSQRNLMGQELDSLTLQDIQQLENQIDTSLNNIRSRKNNLLLKSIAELRQKEKLLMEKNTILEKKITE 177
                       6888899***************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-28284IPR002100Transcription factor, MADS-box
CDDcd002657.48E-36275No hitNo description
PRINTSPR004042.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.79591181IPR002487Transcription factor, K-box
PfamPF014865.4E-2394175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGKVQVRR IENEVSRQVT FSKRRPGLLK KAHEIAVLCD VDVAAIVFSA KGNLFHYASS  60
HTTMERILEK YDRHELLSEG NNVIEEFPEL EGSMSYDHIK LRGRIEALKK SQRNLMGQEL  120
DSLTLQDIQQ LENQIDTSLN NIRSRKNNLL LKSIAELRQK EKLLMEKNTI LEKKITELET  180
LHTCIRASPT KAAAPPACNT ADAFVPNLNI CCGDSGEPET VTAPLGWTSS NNGLPWWMLQ  240
SSSNGKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20174172Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174172Myocyte-specific enhancer factor 2B
1tqe_R2e-20174172Myocyte-specific enhancer factor 2B
1tqe_S2e-20174172Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO298257270.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g31748.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g31748
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2500750.0AY250075.1 Oryza sativa (japonica cultivar-group) MADS20 (MADS20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619865.11e-171PREDICTED: MADS-box transcription factor 20
SwissprotQ2QQA31e-173MAD20_ORYSJ; MADS-box transcription factor 20
TrEMBLI1R6K41e-169I1R6K4_ORYGL; Uncharacterized protein
STRINGLOC_Os12g31748.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP146432121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.12e-63AGAMOUS-like 8