PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g31748.1
Common NameLOC4352275, MADS20, Os12g0501700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 26119.8 Da    PI: 7.5054
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g31748.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.71.8e-241059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rien+  rqvtfskRr g+lKKA+E+ vLCd++va i+fs +g+l+ y+s
  LOC_Os12g31748.1 10 RIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYAS 59
                      8**********************************************986 PP

2K-box69.11.5e-23931731696
             K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       s++ ++ kL+ +ie L+++qR+l+G++L+sL+l+++qqLe+q+++sl++iRs+K++ll+e+   l kk  el+  ++++r+
  LOC_Os12g31748.1  93 SMSYDHIKLRGRIEALKKSQRNLMGQELDSLTLQDIQQLENQIDTSLNNIRSRKEKLLMEKNTILEKKITELETLHTCIRA 173
                       6888999*******************************************************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072161IPR002100Transcription factor, MADS-box
CDDcd002652.58E-36275No hitNo description
SuperFamilySSF554552.22E-28284IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.97391184IPR002487Transcription factor, K-box
PfamPF014864.5E-1893168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKVQVRR IENEVSRQVT FSKRRPGLLK KAHEIAVLCD VDVAAIVFSA KGNLFHYASS  60
HTTMERILEK YDRHELLSEG NNVIEEFPEL EGSMSYDHIK LRGRIEALKK SQRNLMGQEL  120
DSLTLQDIQQ LENQIDTSLN NIRSRKEKLL MEKNTILEKK ITELETLHTC IRASPTKAAA  180
PPACNTADAF VPNLNICCGD SGEPETVTAP LGWTSSNNGL PWWMLQSSSN GKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20174172Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174172Myocyte-specific enhancer factor 2B
1tqe_R2e-20174172Myocyte-specific enhancer factor 2B
1tqe_S2e-20174172Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO298257270.0
Expression AtlasQ2QQA3-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing seeds and seedling shoots. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g31748.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g31748
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2500750.0AY250075.1 Oryza sativa (japonica cultivar-group) MADS20 (MADS20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619865.11e-175PREDICTED: MADS-box transcription factor 20
SwissprotQ2QQA31e-177MAD20_ORYSJ; MADS-box transcription factor 20
TrEMBLA0A0D3HUS41e-172A0A0D3HUS4_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g31748.21e-171(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.14e-56AGAMOUS-like 8
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]