PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g29980.2
Common NameOs12g0484900, OSNPB_120484900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 412aa    MW: 43859 Da    PI: 9.0194
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g29980.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.21.4e-23108152145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  LOC_Os12g29980.2 108 DSEPGRCRRTDGKKWRCSRDAVVDQKYCERHINRGRHRSRKHVEG 152
                       689***************************************986 PP

2QLQ58.61.8e-203773137
               QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      ++FT++Q+++L++Q+l+yK+++an+PvP+ Ll++i++
  LOC_Os12g29980.2 37 GPFTPTQWMELEHQALIYKHIVANAPVPAGLLLPIRR 73
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-113773IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8363873IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.5E-153872IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.527108152IPR014977WRC domain
PfamPF088798.8E-20110151IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MAMATPTTNG SFLLGSGLDC GSSDVARMQG VLARVRGPFT PTQWMELEHQ ALIYKHIVAN  60
APVPAGLLLP IRRSLHPPVF PHFSSGGILG SSSLGWGSFQ LGYSGSADSE PGRCRRTDGK  120
KWRCSRDAVV DQKYCERHIN RGRHRSRKHV EGQSSHAAKA TVPAIAQPPI GASNGKLSGS  180
HGVSNELTKT LATNRMMLDK ANLIERSQDY TNQQHNILQN NTKGDNWSEE MSSQADYAVI  240
PAGSLMNTPQ SANLNPIPQQ QRCKQSLFGK GIQHDDIQLS ISIPVDNSDL PTNYNKAQMD  300
HVVGGSSNGG NNTRASWIPG SWEASIGGPL GEFFTNTSSA SDDKGKSRHP PSLNLLADGH  360
TTSPQLQSPT GVLQMTSFSS VPSSTVSSPA GSLCNGLLTS GLVNAQTVQT L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.767220.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977291840.0
Expression AtlasA0A0P0YA26-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g29980.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g29980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415570.0AK241557.1 Oryza sativa Japonica Group cDNA, clone: J065178H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618985.10.0PREDICTED: growth-regulating factor 7 isoform X2
SwissprotQ6AWY20.0GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLA0A0P0YA260.0A0A0P0YA26_ORYSJ; Os12g0484900 protein (Fragment)
STRINGBGIOSGA037400-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-43growth-regulating factor 2