PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g29980.1
Common NameGRF7, LOC9268363, Os12g0484900, OsJ_36104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 431aa    MW: 45663.9 Da    PI: 9.0038
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g29980.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.11.5e-23127171145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  LOC_Os12g29980.1 127 DSEPGRCRRTDGKKWRCSRDAVVDQKYCERHINRGRHRSRKHVEG 171
                       689***************************************986 PP

2QLQ58.61.9e-205692137
               QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      ++FT++Q+++L++Q+l+yK+++an+PvP+ Ll++i++
  LOC_Os12g29980.1 56 GPFTPTQWMELEHQALIYKHIVANAPVPAGLLLPIRR 92
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-115692IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8365792IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.9E-155791IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.527127171IPR014977WRC domain
PfamPF088799.3E-20129170IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MAMATPTTNG SFLLGSGGYP GAQILSFSSS GHSGNGLDCG SSDVARMQGV LARVRGPFTP  60
TQWMELEHQA LIYKHIVANA PVPAGLLLPI RRSLHPPVFP HFSSGGILGS SSLGWGSFQL  120
GYSGSADSEP GRCRRTDGKK WRCSRDAVVD QKYCERHINR GRHRSRKHVE GQSSHAAKAT  180
VPAIAQPPIG ASNGKLSGSH GVSNELTKTL ATNRMMLDKA NLIERSQDYT NQQHNILQNN  240
TKGDNWSEEM SSQADYAVIP AGSLMNTPQS ANLNPIPQQQ RCKQSLFGKG IQHDDIQLSI  300
SIPVDNSDLP TNYNKAQMDH VVGGSSNGGN NTRASWIPGS WEASIGGPLG EFFTNTSSAS  360
DDKGKSRHPP SLNLLADGHT TSPQLQSPTG VLQMTSFSSV PSSTVSSPAG SLCNGLLTSG  420
LVNAQTVQTL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.767220.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977291840.0
Expression AtlasQ6AWY2-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g29980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g29980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415570.0AK241557.1 Oryza sativa Japonica Group cDNA, clone: J065178H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618984.10.0PREDICTED: growth-regulating factor 7 isoform X1
SwissprotQ6AWY20.0GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLA0A0E0BSS90.0A0A0E0BSS9_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g29980.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP33571226
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-43growth-regulating factor 2
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]