PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g29520.5
Common NameARF24, LOC4352211, Os12g0479400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 754aa    MW: 83464.2 Da    PI: 7.0061
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g29520.5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.65.5e-2460161199
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       f+k+lt sd++++g +++ +++a+e+       +  ++ +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   +
  LOC_Os12g29520.5  60 FCKTLTASDTSTHGGFSVLRRHADEClppldmsQ--HPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--R 148
                       99*****************************544..455569************************************************..4 PP

                       SSEE..EEEEE-S CS
                B3  87 rsefelvvkvfrk 99 
                        +++el+v+v+r+
  LOC_Os12g29520.5 149 GENGELRVGVRRA 161
                       49999*****996 PP

2Auxin_resp1125.9e-37186268183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t+++F+v+Y+Pr+s+seFvv+++ ++++lk++ s+GmRfkm fe+e+++e+r++Gt+vgv d+dp+ W +SkWrsLk
  LOC_Os12g29520.5 186 AWHAVNTGTMFTVYYKPRTSPSEFVVPRDLYKESLKRNHSIGMRFKMTFEGEEAAEQRFTGTIVGVGDSDPSGWADSKWRSLK 268
                       89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.3E-4253175IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.45E-4153189IPR015300DNA-binding pseudobarrel domain
CDDcd100175.65E-2258160No hitNo description
PROSITE profilePS5086311.89960162IPR003340B3 DNA binding domain
PfamPF023627.1E-2260161IPR003340B3 DNA binding domain
SMARTSM010199.8E-2460162IPR003340B3 DNA binding domain
PfamPF065072.8E-34186268IPR010525Auxin response factor
PfamPF023091.1E-11613710IPR033389AUX/IAA domain
PROSITE profilePS5174523.837625709IPR000270PB1 domain
SuperFamilySSF542774.91E-12627701No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MNVELKAEPD TDEVYAQLTL LPEKQQDGNG SGNGNVSKDK VEEEEVVPPA ATERPRVHSF  60
CKTLTASDTS THGGFSVLRR HADECLPPLD MSQHPPTQEL VAKDLHGVEW RFRHIFRGQP  120
RRHLLQSGWS VFVSAKRLVA GDAFIFLRGE NGELRVGVRR AMRQQANIPS SVISSHSMHL  180
GVLATAWHAV NTGTMFTVYY KPRTSPSEFV VPRDLYKESL KRNHSIGMRF KMTFEGEEAA  240
EQRFTGTIVG VGDSDPSGWA DSKWRSLKVR WDEAASVPRP DRVSPWQIEP ANSPSPVNPL  300
PAPRTKRARP NVLASSPDLS AVNKEVASKV MANSQQNGLP RAFHSQENMN LRSRFGDSNE  360
LNTSQKLTMW SSGSNQEKNN VSVQRELGSQ SWMQMRRPDG SSEILSGFQP LKDTRNPLSS  420
FPSQISGNRS NTWNTINVHY PDQNANHNMY PGTWSLMPPN TGFGVNQQNY LMTPDITLPQ  480
RSLNAKFGGN GAFTSLRAHG IDQRSSGWLG HIEPSSHIDD ASSSLIKPQP LVIDHNVQKA  540
KGSSCMLFGI SLDSPAKPEL LISPPSVAFD GKLQQDALEE DECSDPSKTV KPLDGAQHDS  600
AREKHQSCPD GTKNIQSKQQ NGSSRSCKKV HKQGIALGRS IDLTKFTCYD ELIAELDQMF  660
DFNGELNSSS KNWMVVYTDN EGDMMLVGDD PWNEFCNMVH KIFIYTREEV QKMNPGALNS  720
RSEDSRSTSV ERGLVGEGLQ GGLSTPSLNS ENC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-139129578359Auxin response factor 1
4ldw_A1e-139129578359Auxin response factor 1
4ldw_B1e-139129578359Auxin response factor 1
4ldx_A1e-139129578359Auxin response factor 1
4ldx_B1e-139129578359Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183080.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329770790.0
Expression AtlasQ2QQX6-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g29520.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g29520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0652540.0AK065254.1 Oryza sativa Japonica Group cDNA clone:J013002J11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620411.10.0PREDICTED: auxin response factor 24 isoform X1
RefseqXP_015620412.10.0PREDICTED: auxin response factor 24 isoform X1
SwissprotQ2QQX60.0ARFX_ORYSJ; Auxin response factor 24
TrEMBLI1R6D50.0I1R6D5_ORYGL; Auxin response factor
STRINGLOC_Os12g29520.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]