PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g21880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 120aa    MW: 12828.7 Da    PI: 9.199
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g21880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.46e-211360249
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       i+nk +rqvtf+kRr g++KKA+EL  L +a +av++fs+t+  y +
  LOC_Os12g21880.1 13 HIDNKERRQVTFTKRRGGLFKKASELALLAGASIAVVVFSETNLAYAF 60
                      69****************************************998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.18464IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-21578IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-14626IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-19963IPR002100Transcription factor, MADS-box
PfamPF003194.4E-211460IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-142641IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-144162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MRPLGRTSKG RQHIDNKERR QVTFTKRRGG LFKKASELAL LAGASIAVVV FSETNLAYAF  60
GDPSVDAVLL SYGPVPGEDA EPAPVHSGGL GKDVDLEMLR HNNCASSLQF VLVSLSFIM*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QT47
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g21880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g21880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149681e-167AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL7139421e-167AL713942.4 Oryza sativa chromosome 12, . BAC OSJNBa0009F05 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619812.16e-68PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK23e-17AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLQ2QT472e-83Q2QT47_ORYSJ; SRF-type transcription factor family protein
STRINGLOC_Os12g21880.17e-83(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-18AGAMOUS-like 62
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]