PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g13570.1
Common NameOs12g0238000, OSNPB_120238000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 846aa    MW: 93326.6 Da    PI: 4.9739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g13570.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.2e-1955101148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  LOC_Os12g13570.1  55 KGNWTPEEDSILSRAVQTYKGKNWKKIAECFP-DRTDVQCLHRWQKVL 101
                       79******************************.************986 PP

2Myb_DNA-binding60.24.5e-19107153148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  LOC_Os12g13570.1 107 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 153
                       79******************************.*************97 PP

3Myb_DNA-binding47.54.2e-15159201145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  LOC_Os12g13570.1 159 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 201
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.10350101IPR017930Myb domain
SuperFamilySSF466891.52E-1953116IPR009057Homeodomain-like
SMARTSM007174.5E-1754103IPR001005SANT/Myb domain
PfamPF002491.4E-1655101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2457118IPR009057Homeodomain-like
CDDcd001678.54E-1557101No hitNo description
PROSITE profilePS5129431.404102157IPR017930Myb domain
SuperFamilySSF466891.22E-30104200IPR009057Homeodomain-like
SMARTSM007172.2E-17106155IPR001005SANT/Myb domain
PfamPF002492.7E-17107153IPR001005SANT/Myb domain
CDDcd001674.02E-15109153No hitNo description
Gene3DG3DSA:1.10.10.605.1E-26119160IPR009057Homeodomain-like
SMARTSM007174.4E-14158206IPR001005SANT/Myb domain
PROSITE profilePS5129419.654158208IPR017930Myb domain
PfamPF002491.6E-13159202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-21161208IPR009057Homeodomain-like
CDDcd001675.69E-11161201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MSSVMMTSDN GKAPEKGGEA SGPSSAPQEG EISNEPQRRR PLSGRTTGPT RRSTKGNWTP  60
EEDSILSRAV QTYKGKNWKK IAECFPDRTD VQCLHRWQKV LNPELVKGPW SKEEDDIIVQ  120
MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEITL IHAHRMYGNK  180
WAELTKFLPG RTDNAIKNHW NSSVKKKVDS YMSSGLLTQV SCLPLNEYSA HCNSSPALTQ  240
QNSEDSGSYA VREVENSSVC SQSSLAKVSC SQVHNANVAL GCDLQVNANV DNNEAHDSQS  300
SVGHEACYTS VGAVATAIPE VHYHVSSSNF DPDQHLQEEF AQGLNLHMSM DEVPSNSSFA  360
DNPTICSIEN HERSLEPYDV AMEMPLSMLP SDSGAEQKLH FMSEADFNSP NCLKSELWQD  420
ISLQSLLSGP DAVETDSFSR SNHQSDVYSS QADNEFLAPP YLLQTSNSSS VMEATYGQSP  480
QMSVPPSLIC SNVMTDVPSD NRSEPKEMTV SQAEMVTQSS SSSGDAEMSA NPGSSNGSDI  540
PSMMERIPEC ADQHVTNAEE PEASIEKEPS VTPSATADEK QDEGALFYEP PRFPSMDVPF  600
VSCDLVTSGD LQEYSPLGIR QLMRSTMNVC TPMRLWGSPT HDESPDILLK SAAKSFICTP  660
SILKKRHRDL VSPIPDKRIE KKSGTEKDCG VSDTSSIGIQ TCFINATKDD AVITKSVLRI  720
ERSASSKPLE KKLEFSDENK ENLDNTIEQA KDGQSAGNYK HIDEQARGER RTATNITTTY  780
DDLPGNLQPA GILIEHNGDD LVSPDYGKNT MNRSKTQIWN LCQSVRRECL LKSLRNLLWR  840
NLQHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-65552086159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-65552086159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.237470.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO563827590.0
Expression AtlasA0A0P0Y8F4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g13570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g13570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663924.20.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLA0A0P0Y8F40.0A0A0P0Y8F4_ORYSJ; Os12g0238000 protein
STRINGLOC_Os12g13570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-95Homeodomain-like protein