PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g12970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 453aa    MW: 48036.8 Da    PI: 5.8972
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g12970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.43.7e-25366416252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       +k+++l+d++ yF+lpi++AAk+L++c+T+LK iCR++G+ RWP+Rk++s+
  LOC_Os12g12970.1 366 TKQLQLSDIAPYFELPIAKAAKKLDICATALKGICRKHGVLRWPYRKVRSI 416
                       89**********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086356438IPR003035RWP-RK domain
PfamPF020422.9E-21369416IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MAGDGGNGAA DGGGEHLELD FFPSPLLDNF DVLELLDLSV LGDVDDDGAP PAPAPVQMSV  60
DGAGGGRINK PGSSVDDLVD WSTAFGNNCS KIDGEYGGAS TSSSAAPALA PPQEDYCSGC  120
QVLREVVHSN GLEITKLCIH GGVASGEFYH AILDVYRVSA SAPAPALAHH SIINFRGRGY  180
DWVKQYLTEY ALRRAGGGFA VVQDSLSAFH DALCTTMAPC SSHVGDDDAH RRASSSAAAA  240
AEERTNGNGD HGQLVVHNAA VLPMLESSRC LVAADQAATT NNNGSGDRRL VVLDTTAIQP  300
PASGCILHMA FPSKSYQSSR PTTLPSRYQE CTCNPVAYEM DGVRSSLAPI CWPELLGYNV  360
TNREKTKQLQ LSDIAPYFEL PIAKAAKKLD ICATALKGIC RKHGVLRWPY RKVRSIDRQI  420
ATLRRSGNGD ATRNEIETLI ASRRRIVAGL DQ*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QVF7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g12970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g12970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9541600.0AL954160.5 Oryza sativa chromosome 12, . BAC OSJNBb0078J08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL8318060.0AL831806.5 Oryza sativa chromosome 12, . BAC OSJNBb0106P21 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664445.11e-115PREDICTED: uncharacterized protein LOC102713973
TrEMBLQ2QVF70.0Q2QVF7_ORYSJ; RWP-RK domain containing protein
STRINGLOC_Os12g12970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5671777
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-13RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]