PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g10630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 295aa    MW: 31317.5 Da    PI: 9.3545
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g10630.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.54.8e-3171126359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       ++rY+eClkNhAa++Gg a+DGCgEfmp  geeg+ +al+C+ACgCHRnFHR+e + 
  LOC_Os12g10630.1  71 AARYRECLKNHAAAIGGSATDGCGEFMPG-GEEGSLDALRCSACGCHRNFHRKELDA 126
                       689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.2E-2872123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2273125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-2973123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.52474123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.0E-21180242IPR009057Homeodomain-like
SuperFamilySSF466891.73E-11183242IPR009057Homeodomain-like
TIGRFAMsTIGR015657.6E-20193242IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDLSGAQGEL PLPMHAAASP YLGLHHDHHH HHGGGGGGGG MNGRHMSPPT PPAAAEESKA  60
VVVVSSSATA AARYRECLKN HAAAIGGSAT DGCGEFMPGG EEGSLDALRC SACGCHRNFH  120
RKELDAAAAP PLHHHHHQLL GVGAHPRGHG HHHHHLLVAA LPPPTRMVMP LSAMHTSESD  180
DAAARPGGGA AARKRFRTKF TAEQKARMLG FAEEVGWRLQ KLEDAVVQRF CQEVGVKRRV  240
LKYGSGAPEE LKKLDFFWER RGGGGGNPLR NKMKIHLASA STSIRLQLSP TETL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-171932421766ZF-HD homeobox family protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g10630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g10630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9548530.0AL954853.5 Oryza sativa chromosome 12, . BAC OSJNBb0071I17 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618832.11e-173PREDICTED: zinc-finger homeodomain protein 3
SwissprotQ2QW441e-175ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLA0A0E0FAJ11e-131A0A0E0FAJ1_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g10630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-42homeobox protein 31