PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g10540.3
Common NameLOC4351753, MADS13, MAF1, Os12g0207000, OsJ_35557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 271aa    MW: 30268.5 Da    PI: 9.5082
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g10540.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.2e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  LOC_Os12g10540.3  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                      79***********************************************95 PP

2K-box100.62.1e-338617610100
             K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek+++kiR++Knell ++i+++ k+e elq++n++Lr+k++e
  LOC_Os12g10540.3  86 EVNAQQYYQQESAKLRHQIQMLQNTNKHLVGDNVSNLSLKELKQLESRLEKGISKIRARKNELLASEINYMAKREIELQNDNMDLRTKIAE 176
                       567789**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.557161IPR002100Transcription factor, MADS-box
CDDcd002651.34E-41275No hitNo description
SuperFamilySSF554555.36E-32276IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.6E-2587174IPR002487Transcription factor, K-box
PROSITE profilePS5129715.14190180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010622Biological Processspecification of ovule identity
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
NNVKATIDRY KKAHACGSTS GAPLIEVNAQ QYYQQESAKL RHQIQMLQNT NKHLVGDNVS  120
NLSLKELKQL ESRLEKGISK IRARKNELLA SEINYMAKRE IELQNDNMDL RTKIAEEEQQ  180
LQQVTVARSA AMELQAAAAA QQQQQNPFAV AAAQLDMKCF FPLNLFEAAA QVQAVAAQRQ  240
QIIPTELNLG YHHHLAIPGA AAADAPPPHF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S8e-19161161Myocyte-specific enhancer factor 2B
1tqe_R8e-19161161Myocyte-specific enhancer factor 2B
1tqe_Q8e-19161161Myocyte-specific enhancer factor 2B
1tqe_P8e-19161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23450.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329804490.0
Expression AtlasQ2QW53-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development. First detected in the ovule primordia and later in the inner and outer integuments, nucellus tissue and the inner layer of the carpel wall. {ECO:0000269|PubMed:10528264}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g10540.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q2QW53
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g10540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509410.0FJ750941.1 Oryza sativa clone KCS112D08 MADS-box transcription factor 13 mRNA, complete cds.
GenBankAY3324750.0AY332475.1 Oryza sativa (japonica cultivar-group) MADS protein (MAF1) mRNA, complete cds.
GenBankAK0704250.0AK070425.1 Oryza sativa Japonica Group cDNA clone:J023050A03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618486.10.0PREDICTED: MADS-box transcription factor 13 isoform X2
RefseqXP_015618487.10.0PREDICTED: MADS-box transcription factor 13 isoform X2
SwissprotQ2QW530.0MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLA0A0E0RF260.0A0A0E0RF26_ORYRU; Uncharacterized protein
TrEMBLD3U2H30.0D3U2H3_ORYSA; MADS-box transcription factor 13
STRINGLOC_Os12g10540.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-82MIKC_MADS family protein
Publications ? help Back to Top
  1. Lopez-Dee ZP, et al.
    OsMADS13, a novel rice MADS-box gene expressed during ovule development.
    Dev. Genet., 1999. 25(3): p. 237-44
    [PMID:10528264]
  2. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  3. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  4. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]