PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g10520.1
Common NameLOC4351752, MADS33, Os12g0206800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23232.9 Da    PI: 9.8493
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g10520.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.17.1e-261058250
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      rien   rqvtf+kRr g+lKKA ELSvLCda+v viifss+gkl+e +
  LOC_Os12g10520.1 10 RIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELA 58
                      8*********************************************965 PP

2K-box52.22.7e-188717314100
             K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       ++  +q +  L++ei+ Lqr +R   G + ++++l  L+ Le+ Le  + +iR++K++++ ++i+ l++ke  l+e+n++L++k++e
  LOC_Os12g10520.1  87 QQVAEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKEANEMLQEKVKE 173
                       5666788889**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.464161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-28174IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.42E-38373No hitNo description
PRINTSPR004047.1E-27323IPR002100Transcription factor, MADS-box
PfamPF003196.4E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.64187177IPR002487Transcription factor, K-box
PfamPF014865.5E-1988171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRQVT FCKRRGGLLK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMHNLVERY QSNVAGGQME PGALQRQQVA EQGIFLLREE IDLLQRGLRS TYGGGAGEMT  120
LDKLHALEKG LELWIYQIRT TKMQMMQQEI QFLRNKEGIL KEANEMLQEK VKEQQKLYMS  180
LLDLHSQQPT QPMTYGNRFF SI*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QW55
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedling roots. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g10520.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g10520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777000.0AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618440.11e-148PREDICTED: MADS-box transcription factor 33
SwissprotQ2QW551e-150MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLI1R4V71e-148I1R4V7_ORYGL; Uncharacterized protein
STRINGLOC_Os12g10520.11e-147(Oryza sativa Japonica Group)
STRINGORGLA12G0056300.11e-147(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-60AGAMOUS-like 12
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]