PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g09250.1
Common NameLOC4351714, Os12g0194600, OSNPB_120194600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 370aa    MW: 40377.8 Da    PI: 10.0483
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g09250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-072372701750
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       A+rsR RK+++i+eLe++v++L++e  +   e++
  LOC_Os12g09250.1 237 AQRSRVRKLQYIAELERRVQALQTEGVEVSAEMD 270
                       89*********************99776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-6226285IPR004827Basic-leucine zipper domain
CDDcd147037.37E-16227277No hitNo description
SuperFamilySSF579595.46E-6236279No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-6237291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MMANARFQKQ ALLPPRSPFP AAVGAAPSPS PHAELGPIAR PRDAPHRHGH QRTSSESVLI  60
DEQPSWLDDL LAEPEAPARP HGRPGHRRSS SDSFTLFDGG ASAAAAGMYD NVFDGMRGRG  120
GGGQQVGSWG AAPEFFPEQS SFGRPQGQGG RPWDSRLMLR QGGGGGGGMP VPMNGGHHGP  180
PSAFGDHGHG SLPNGVDRKG PGDSAHDQRM GAERKEGAHL RHSQSEADTK RAKQQYAQRS  240
RVRKLQYIAE LERRVQALQT EGVEVSAEMD FLGQQNIMLD LENKALKQRL ESLSQEHLIK  300
RFQQEMFERE IGRLRSLFQQ QQQQQHIPQQ QGPTHSRSNS RDLDSQFANM SLKHGDPNSG  360
RDAVPGLRI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.181920.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567641700.0
Expression AtlasA0A0P0Y7R8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g09250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g09250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877160.0AK287716.1 Oryza sativa Japonica Group cDNA, clone: J065134G21, full insert sequence.
GenBankAK2875550.0AK287555.1 Oryza sativa Japonica Group cDNA, clone: J065019F14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618309.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A0P0Y7R80.0A0A0P0Y7R8_ORYSJ; Os12g0194600 protein
STRINGLOC_Os12g09250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP42521219
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.28e-48bZIP family protein