PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g07640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 267aa    MW: 28647.9 Da    PI: 8.2353
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g07640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+  ++q+G g+W++ ++  g+ R++k+c++rw +yl
  LOC_Os12g07640.1 14 KGAWTKEEDQRLIAHINQHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding59.95.5e-1967111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  LOC_Os12g07640.1  67 RGNFTDEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.531961IPR017930Myb domain
SuperFamilySSF466891.01E-2913108IPR009057Homeodomain-like
SMARTSM007178.1E-141363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001673.67E-111661No hitNo description
PROSITE profilePS5129429.11662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2865116IPR009057Homeodomain-like
SMARTSM007174.9E-1866114IPR001005SANT/Myb domain
PfamPF002495.1E-1767111IPR001005SANT/Myb domain
CDDcd001672.69E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIN QHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDELIIK LHELLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
LDPLTHRPLN AAAAVAGHHH LAAGGSSCSP DATSGHSSCS DGDEYRGGID LNLSISPPSS  180
SSQPSSPPPP PHEAEARRAG ATASYTYHHH YSETREKICL CLNHLGLHGG DECSCGGSSA  240
SSSSSPPPAT ASSRAFTFAN ASSSTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.515400.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977288980.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g07640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g07640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0630270.0AK063027.1 Oryza sativa Japonica Group cDNA clone:001-110-B12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618922.10.0PREDICTED: myb-related protein 308
SwissprotP813934e-89MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0E0REG70.0A0A0E0REG7_ORYRU; Uncharacterized protein
STRINGLOC_Os12g07640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-86myb domain protein 4