PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g07610.1
Common NameOs12g0175000, OSNPB_120175000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 379aa    MW: 42844 Da    PI: 5.8606
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g07610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-17131177148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT eEd +lv++v+q+G + W++I  +++ gR +kqc++rw+++l
  LOC_Os12g07610.1 131 KGHWTVEEDRKLVKLVEQFGLKKWSLIGGMLP-GRVGKQCRERWFNHL 177
                       789*****************************.*************97 PP

2Myb_DNA-binding52.61e-16183225145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  LOC_Os12g07610.1 183 KDTWSEEEDMVLIQIHKEVGNR-WAEIAKCLP-GRTENSIKNHWN 225
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.07126181IPR017930Myb domain
SuperFamilySSF466892.26E-31129224IPR009057Homeodomain-like
SMARTSM007173.2E-15130179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-27132184IPR009057Homeodomain-like
CDDcd001675.41E-14134177No hitNo description
PfamPF139211.3E-17134191No hitNo description
PROSITE profilePS5129418.645182232IPR017930Myb domain
SMARTSM007179.2E-17182230IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-22185230IPR009057Homeodomain-like
CDDcd001675.07E-13185228No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDFSCFNPQP AISHGIPFDS FLLQDELHHH ADLDHPFEAE GITVHGSELE GGSVLPFATL  60
HDLDHEFFRR GSRKDFIDNA SSIFLLNPKT EVSHLVRDVQ VGAFGAYEMN GRLISRNKAS  120
RKGIKKADAV KGHWTVEEDR KLVKLVEQFG LKKWSLIGGM LPGRVGKQCR ERWFNHLRPN  180
IKKDTWSEEE DMVLIQIHKE VGNRWAEIAK CLPGRTENSI KNHWNATKRR QFARRRNRST  240
SKSGSTVLQN YIKSLAISPQ ESQMNNERSE SNPSDMMITQ GTPCCFDGNN CSQSHTSEEN  300
IVPSCGDFAA EMWSGLFDTK EDEEDEAQYL LYDMDTHVDM NCIFSNMDYG SNIEPGLASV  360
VKAECSAESW AVNLKETD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-451302313104C-Myb DNA-Binding Domain
1msf_C9e-451302313104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0Y7N5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g07610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g07610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL7326380.0AL732638.6 Oryza sativa chromosome 12, . Partial sequence from BAC OSJNBa0010K22 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619155.10.0PREDICTED: transcription factor MYB98-like
TrEMBLA0A0E0REG60.0A0A0E0REG6_ORYRU; Uncharacterized protein
TrEMBLA0A0P0Y7N50.0A0A0P0Y7N5_ORYSJ; Os12g0175000 protein
TrEMBLQ2QX050.0Q2QX05_ORYSJ; Myb family transcription factor, putative
STRINGLOC_Os12g07610.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-63myb domain protein 98