PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g07120.1
Common NameOs12g0168800, OSNPB_120168800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 384aa    MW: 40207.1 Da    PI: 10.6219
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g07120.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA45.97.7e-15120152133
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                       C nC + +Tp+WR+gp g +tLCnaCG++ r  
  LOC_Os12g07120.1 120 CLNCDAVETPQWRSGPMGRSTLCNACGVRLRAV 152
                       99**************************99865 PP

2GATA56.92.7e-18248282135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++Cg+t+Tp+WR+gp g  tLCnaCG++yr  +l
  LOC_Os12g07120.1 248 CVHCGSTETPQWREGPTGRGTLCNACGVRYRQGRL 282
                       *******************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR012175.8E-144759No hitNo description
PRINTSPR012175.8E-146682No hitNo description
SuperFamilySSF577161.47E-12113155No hitNo description
PROSITE profilePS5011412.097114153IPR000679Zinc finger, GATA-type
SMARTSM004015.0E-12114165IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.8E-13118152IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.96E-9119153No hitNo description
PfamPF003203.4E-12120151IPR000679Zinc finger, GATA-type
PROSITE patternPS003440120145IPR000679Zinc finger, GATA-type
PRINTSPR012175.8E-14170186No hitNo description
PRINTSPR012175.8E-14189206No hitNo description
PRINTSPR012175.8E-14217242No hitNo description
PROSITE profilePS5011412.716242278IPR000679Zinc finger, GATA-type
SMARTSM004013.1E-16242292IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-15244304No hitNo description
Gene3DG3DSA:3.30.50.108.2E-15246280IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.27E-15247304No hitNo description
PfamPF003204.2E-16248282IPR000679Zinc finger, GATA-type
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDGDGDVGGG GGGGGGGGVR YVLALPAMAS LAVLIAHLDA AVPVPRRPRS YLPRAVPMAW  60
WAFRLPVFRP PPPPPPPPAK NPVKEEEGVA RVVVVVAPPP PVDPGEEEAG KRAAKRARRC  120
LNCDAVETPQ WRSGPMGRST LCNACGVRLR AVGSLPEHRA PAARTTTAAP ASPPDSPIWT  180
PGHKPPSSSP DIYLVRRTPK LPVTRPPRTK QAPPTAPAPA PPPPPPQPAS PKTKTKAKAK  240
KPKRKRSCVH CGSTETPQWR EGPTGRGTLC NACGVRYRQG RLLPEYRPKG SPTFSPSVHA  300
ANHRQVLELR RQQRQSTNPS TPPPPPVSAA EPIPDEQKEE VVSVPVAAAA PATDGGAASS  360
LDALLLDGPS APLIVDGDDF LVS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.526120.0callus| flower| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329783240.0
Expression AtlasQ0IPT9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g07120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g07120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9548250.0AL954825.3 Oryza sativa chromosome 12, . BAC OJ2007_H06 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK0683060.0AK068306.1 Oryza sativa Japonica Group cDNA clone:J013136H07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620068.10.0PREDICTED: vegetative cell wall protein gp1
TrEMBLA0A0E0J7890.0A0A0E0J789_ORYNI; Uncharacterized protein
TrEMBLQ0IPT90.0Q0IPT9_ORYSJ; Os12g0168800 protein
STRINGORGLA12G0039500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP72732646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-23GATA transcription factor 11