PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g06380.1
Common NameLOC4351567, Os12g0160900, OsJ_35306, OSNPB_120160900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 818aa    MW: 93406.5 Da    PI: 5.0992
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g06380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR177.13.4e-2497183290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Y++Y++++GFsvrk k+++ + +++i +++++Cskeg +++e+ +  +++ +++ trt+Cka+++ + +++g+w+v++++ eHnHel+
  LOC_Os12g06380.1  97 LYCDYGHRMGFSVRKGKQYYFTGTKTIRTKDYYCSKEGLKDDEQLT--EANFNKPDTRTNCKAMVRYRVDSEGHWRVIQIVPEHNHELV 183
                       7*****************************************9988..9999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.4E-2297183IPR004330FAR1 DNA binding domain
PfamPF105512.1E-26294388IPR018289MULE transposase domain
PROSITE profilePS509669.557576612IPR007527Zinc finger, SWIM-type
PfamPF044341.1E-4578608IPR007527Zinc finger, SWIM-type
SMARTSM005751.0E-6587614IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MEETSIAIEI DGEAICLDSV GDNEEQGTQE NQEIQIIYDA ENEGQVAFDN GEQGKEEHPM  60
RNEEENQENI PVIPSREELT EELRNKIANS EEEAYRLYCD YGHRMGFSVR KGKQYYFTGT  120
KTIRTKDYYC SKEGLKDDEQ LTEANFNKPD TRTNCKAMVR YRVDSEGHWR VIQIVPEHNH  180
ELVRPEEVHL LRSVRTLSIP KPGVLNAMVN AEIQAMHENL HMNDDGAECQ SQLGIQSYTL  240
LEPEDSEALV GYFKRRTIEQ GMFYWDVLVE DGRMTNFFWR DGRSRVDYDC FGDVVVFDTA  300
YRTSKYNMIC APFVGVNHHG QDVMLGCALL LDESLTSYEW LFKSFLDSMG GHPPKTIFTV  360
MAETISKAIE GVLPETRHCI CQWSIEKNLQ SHLGTLNVSG TFHSMLTKCM RECESEAEFE  420
ETWAMMLNEC NMQDDQWLSD LYQQRRKWST VHHRDAFDGG INSLDRSDSS NNVLSSIANE  480
STSPTQFILD FDKLVGSWRT NESAEDIQCT QTSPESRVKH RSILEHAAEV YTRKVYKSLE  540
TEYLDGCSAT SYQEMQCSET LYRFEFILQR SGPKVQVVFL DTSTMELSCT CKKFETTGIL  600
CSHAINALDL KNFDRIPERY VLKRWKKYVR KGTYLFPSDE FVGQDCTEPG LAFRNKAMRF  660
VYDLLMKSKG HQDTRKLILD VFENGEKLVE SLCELKRLNA HASGREKDGS KVEKRKKKSA  720
KQEKSSRNVK QAVSSQTADT VLVDPPNQNQ YFATEDMATN SSIGRPFFYQ GFPSAGVSTS  780
QIQGHTNIHS VPQCAPQEYS AYGAAHPPPT FGGGRNF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.243020.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329758560.0
Expression AtlasQ2QXD6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g06380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g06380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658380.0AK065838.1 Oryza sativa Japonica Group cDNA clone:J013039J03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620809.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
TrEMBLB8BNA60.0B8BNA6_ORYSI; Putative uncharacterized protein
TrEMBLQ2QXD60.0Q2QXD6_ORYSJ; Os12g0160900 protein
STRINGBGIOSGA037035-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g06380.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1476744
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-85FAR1-related sequence 5
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]