PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g04380.1
Common NameOsJ_35170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 465aa    MW: 50674.5 Da    PI: 6.3949
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g04380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.18.9e-91343819374
              GRAS  19 laqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshltaNqaIleave 107
                       +a+++Lar   l  a+ +g  p +Rla  ++  La+rl+r v+ + +al  ps     +  ++ aa++ f+e+sP++k+++++ N+aI+eave
  LOC_Os12g04380.1   3 KATRCLARATGLaaAAAAGdGPQKRLAEAMVDCLARRLLRPVQAITDALiDPSVYL--DRRSVRAARRGFFELSPFPKVAFVVGNRAIVEAVE 93 
                       68888888887755455554799**********************99995444443..34555578899************************ PP

              GRAS 108 geervHiiDfd..isqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL... 194
                       +e+ vH++ ++   +q+ QW+ Ll++L  Rpegpp  +R+T+v++    + e l +++e L++ Aeel+++f+f+  v+ +ledl++++L   
  LOC_Os12g04380.1  94 NESLVHVVGMSgpFTQPCQWIQLLHELRRRPEGPPrVVRLTVVHD----DGELLAKMAEVLSDEAEELDMEFQFHG-VVGQLEDLDFSNLrdv 181
                       **********86679****************9988789*******....***************************.7999****99998766 PP

              GRAS 195 .rvkpgEalaVnlvlqlhrll...................................................................desvs 219
                        ++k+gEal+V++ lqlhrll                                                                     +++
  LOC_Os12g04380.1 182 lEIKSGEALVVSCTLQLHRLLaadddamyssrsahlnqmasiaqlqqmavsscppstggggsvqykdddddpyrspatpltfvsppasTPHLQ 274
                       68999*********************************************************************************8755555 PP

              GRAS 220 leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpres........eerikvErellgreivnvvacega 303
                       ++ +  ++L++v+ lsPk+vvv+eq+adhn+ sF +rf+eal++y+a+fdsl +a ++++s        +er+ vEr+++g+ei+ v+   ga
  LOC_Os12g04380.1 275 MPAALANFLSAVRALSPKIVVVAEQDADHNGVSFRKRFCEALHHYAAVFDSLdDAAAATTSaashlwspDERAQVERVVVGEEIKGVLLRDGA 367
                       5557778*********************************************766666666788899999*********************** PP

              GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +rrerh +l++W +r+e+aGF+ vpls+ a  + + ++r+++ +  +  e  g+l+l+W++rpL+s+SaWr
  LOC_Os12g04380.1 368 HRRERHDRLRQWAARMEMAGFTGVPLSYAAIRKGNDMVRRCGLRRCENRECGGCLLLCWSSRPLYSISAWR 438
                       ******************************************887888899*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.2771418IPR005202Transcription factor GRAS
PfamPF035143.0E-883438IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEKATRCLAR ATGLAAAAAA GDGPQKRLAE AMVDCLARRL LRPVQAITDA LIDPSVYLDR  60
RSVRAARRGF FELSPFPKVA FVVGNRAIVE AVENESLVHV VGMSGPFTQP CQWIQLLHEL  120
RRRPEGPPRV VRLTVVHDDG ELLAKMAEVL SDEAEELDME FQFHGVVGQL EDLDFSNLRD  180
VLEIKSGEAL VVSCTLQLHR LLAADDDAMY SSRSAHLNQM ASIAQLQQMA VSSCPPSTGG  240
GGSVQYKDDD DDPYRSPATP LTFVSPPAST PHLQMPAALA NFLSAVRALS PKIVVVAEQD  300
ADHNGVSFRK RFCEALHHYA AVFDSLDDAA AATTSAASHL WSPDERAQVE RVVVGEEIKG  360
VLLRDGAHRR ERHDRLRQWA ARMEMAGFTG VPLSYAAIRK GNDMVRRCGL RRCENRECGG  420
CLLLCWSSRP LYSISAWRPA ASGGAGSGSE RSEYIHVGAE ADDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-141543831375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QXZ5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g04380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g04380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9351540.0AL935154.2 Oryza sativa chromosome 12, . BAC OSJNBb0109O08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619131.10.0PREDICTED: scarecrow-like protein 3
TrEMBLQ2QXZ50.0Q2QXZ5_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os12g04380.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1542634
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.15e-75scarecrow-like 3
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]