PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g04370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 978aa    MW: 108691 Da    PI: 7.018
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g04370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS34.42.9e-11201272110
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkf 93 
                       v lL ecA +v++g++e+a+   ++++ l   ++ p+q l + ++  L +rl++s ++ly al +ps+   ++s+      + f+++ P+l  
  LOC_Os12g04370.1  20 VPLLHECASHVTEGSFEKADFSFKKIRMLT-IADGPLQHLSKIIVDSLDHRLLSSIQGLYGALiNPSDYF-EKSTLPGCPAHNFFKLNPYLST 110
                       6789**********************9876.5667**************************995666655.4555555555789********* PP

              GRAS  94 shltaNqaIleavegee 110
                       +++t N+aI+ea+e e+
  LOC_Os12g04370.1 111 GFVTINRAIMEAMEDEK 127
                       **************986 PP

2GRAS205.82.4e-63169476109371
              GRAS 109 eervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp. 198
                        + vHi+D++ s  ++ QW+ Ll+ +  Rp+g+p+l +T++++    +++ l e+++ L+k Ae+l+v+f+f   v  rle+l++++Lr    
  LOC_Os12g04370.1 169 LQVVHIVDLSCSaaHPWQWLKLLDDFHGRPGGAPELYLTVLHD----DNDFLAEMQSLLSKKAESLEVSFRFIS-VIGRLETLDFSNLRSTFq 256
                       4789*****8653389***************************....9**************************.799**********54444 PP

              GRAS 199 ...gEalaVnlvlqlhrll.........................................desvsleserdevLklvkslsPkvvvvveqead 247
                          g a+a++++lq+hrll                                           s  +++   ++L++++ l+P+++v++eq+ad
  LOC_Os12g04370.1 257 ikfGVAVAISCALQMHRLLlvddnlsstsiaqlqkmanftqpkqmassvcspastlnylqTPSPRTPKLLARLLSAIRALKPNIMVIMEQDAD 349
                       555*******************************************************98666777778899********************* PP

              GRAS 248 hnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                       hn+  F +rf e l+yy+alfd+++a ++++    +er  vEr++l++ei+n++ ceg +r erhe+l +W + +ee+GF++v+ls +a  + 
  LOC_Os12g04370.1 350 HNALLFRDRFNEVLNYYAALFDCFHAVAAANPgrtDERLRVERMILREEIKNILVCEGVHRHERHERLDQWAMHMEESGFHNVQLSFSAIREG 442
                       ************************77654444456********************************************************** PP

              GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       k  l  ++ +  + +e++g+l+l W + +L+s+S
  LOC_Os12g04370.1 443 KENLLSFGLKNCQNKEDRGCLLLSWGSTNLYSIS 476
                       ********888*********************99 PP

3GRAS356.24.9e-1095299662374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       + lL++cA  vs+g++ +a+ +L+++ +las d+  ++qRlaa+f+ ALa++l++  ++l++al +s++s +    +  a++  ++v P+lk+
  LOC_Os12g04370.1 529 IGLLYQCAAEVSAGSFDRANLCLEHITQLASLDApHALQRLAAVFADALARKLLNLIPGLSRALLSSANSADA-HLVPVARRHMFDVLPFLKL 620
                       679*******************************9*****************************888887544.44446778899******** PP

              GRAS  94 shltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       ++lt+N+aIlea+ege+ vH++Df+  + +++QW+aL++a+  R+egpp+lRiT+v++    ske l +++  L+k Ae++++ f+fn+ v+ 
  LOC_Os12g04370.1 621 AYLTTNHAILEAMEGERFVHVVDFSgpAANPVQWIALFHAFRGRREGPPHLRITAVHD----SKEFLANMAAVLSKEAEAFDIAFQFNA-VEA 708
                       ************************966899****************************....9**************************.799 PP

              GRAS 185 rledleleeL....rvkpgEalaVnlvlqlhrll........................................................... 214
                       +l+++++++L     v++gEalaV++vlqlhrll                                                           
  LOC_Os12g04370.1 709 KLDEMDFDALrhdlGVRSGEALAVSVVLQLHRLLavddgrrhaatgcltpvqiiarssprsfgellerelntrlqlspdasvvsslsphspaa 801
                       9**999998843335667*************************************************************************** PP

              GRAS 215 ...desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae 304
                          +++++++ +  ++L++v+slsPk++v++eqea+hn++ F erf eal+yy++lfd+l+ + ++++ er+ vEr+llg+ei+ vvacegae
  LOC_Os12g04370.1 802 ataAHPTTSTPKLGSFLSAVRSLSPKIMVMTEQEANHNGGAFQERFDEALNYYASLFDCLQRS-AAAAAERARVERVLLGEEIRGVVACEGAE 893
                       *98555555556999*********************************************999.68889************************ PP

              GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrveee..sgslvlgWkdrpLvsvSaWr 374
                       r+erhe++++W +r+e+aG+++v ls++ a++a+ ll+ +++ g y+v ++   + ++++W++rpL++v+aWr
  LOC_Os12g04370.1 894 RTERHERARQWAARMEAAGMESVGLSYSGAMEARKLLQSCGWVGpYEVRHDagGHGFFFCWHKRPLYAVTAWR 966
                       *****************************************6666****884345678**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.6241459IPR005202Transcription factor GRAS
PfamPF035141.0E-820127IPR005202Transcription factor GRAS
PfamPF035148.3E-61169476IPR005202Transcription factor GRAS
PROSITE profilePS5098550.353502943IPR005202Transcription factor GRAS
PfamPF035141.7E-106529966IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MMHGLWVQDQ GMVDHLAQLV PLLHECASHV TEGSFEKADF SFKKIRMLTI ADGPLQHLSK  60
IIVDSLDHRL LSSIQGLYGA LINPSDYFEK STLPGCPAHN FFKLNPYLST GFVTINRAIM  120
EAMEDEKNFL EIKVKSNLCS ILKLSHYNFK TLQGAIYVER SLMFNMVELQ VVHIVDLSCS  180
AAHPWQWLKL LDDFHGRPGG APELYLTVLH DDNDFLAEMQ SLLSKKAESL EVSFRFISVI  240
GRLETLDFSN LRSTFQIKFG VAVAISCALQ MHRLLLVDDN LSSTSIAQLQ KMANFTQPKQ  300
MASSVCSPAS TLNYLQTPSP RTPKLLARLL SAIRALKPNI MVIMEQDADH NALLFRDRFN  360
EVLNYYAALF DCFHAVAAAN PGRTDERLRV ERMILREEIK NILVCEGVHR HERHERLDQW  420
AMHMEESGFH NVQLSFSAIR EGKENLLSFG LKNCQNKEDR GCLLLSWGST NLYSISLRLC  480
CTDRGMFQDD MLSSATSSPA SSVYSPSPSP SNGSWVQELS HDQQSVRLIG LLYQCAAEVS  540
AGSFDRANLC LEHITQLASL DAPHALQRLA AVFADALARK LLNLIPGLSR ALLSSANSAD  600
AHLVPVARRH MFDVLPFLKL AYLTTNHAIL EAMEGERFVH VVDFSGPAAN PVQWIALFHA  660
FRGRREGPPH LRITAVHDSK EFLANMAAVL SKEAEAFDIA FQFNAVEAKL DEMDFDALRH  720
DLGVRSGEAL AVSVVLQLHR LLAVDDGRRH AATGCLTPVQ IIARSSPRSF GELLERELNT  780
RLQLSPDASV VSSLSPHSPA AATAAHPTTS TPKLGSFLSA VRSLSPKIMV MTEQEANHNG  840
GAFQERFDEA LNYYASLFDC LQRSAAAAAE RARVERVLLG EEIRGVVACE GAERTERHER  900
ARQWAARMEA AGMESVGLSY SGAMEARKLL QSCGWVGPYE VRHDAGGHGF FFCWHKRPLY  960
AVTAWRPAAS RRGHTRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3055896632375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575640.0callus| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329904460.0
Expression AtlasQ2QXZ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g04370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g04370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9351540.0AL935154.2 Oryza sativa chromosome 12, . BAC OSJNBb0109O08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441716.10.0hypothetical protein SORBIDRAFT_08g001190
TrEMBLQ2QXZ60.0Q2QXZ6_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os12g04370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25641433
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-100scarecrow-like 3
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]