PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g03050.1
Common NameLOC4351370, NAC300, NAC77, Os12g0123800, OsJ_35059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 397aa    MW: 43848.1 Da    PI: 9.1777
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g03050.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.58.9e-52191601128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtd e++  yL +k+ + +++    i evd++k+ePwdLp+k+k +ekewyfFs++d ky+tg r+nratk+gyWkatgkd+e++
  LOC_Os12g03050.1  19 LPPGFRFHPTDAEVILSYLLQKLLNPSFTS-LPIGEVDLNKCEPWDLPSKAKMGEKEWYFFSHKDMKYPTGMRTNRATKEGYWKATGKDREIF 110
                       79*************************888.56***************99999**************************************** PP

               NAM  94 sk...............kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++               k++lvg+kktLvfy grapkg+kt+Wvmhe+rl
  LOC_Os12g03050.1 111 RQpaavntssyggssnkKKQLVGMKKTLVFYMGRAPKGTKTNWVMHEFRL 160
                       *99999888888887766667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-5916187IPR003441NAC domain
PROSITE profilePS5100553.73319187IPR003441NAC domain
PfamPF023651.6E-2520160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVESTTSLVK LEQDGGLFLP PGFRFHPTDA EVILSYLLQK LLNPSFTSLP IGEVDLNKCE  60
PWDLPSKAKM GEKEWYFFSH KDMKYPTGMR TNRATKEGYW KATGKDREIF RQPAAVNTSS  120
YGGSSNKKKQ LVGMKKTLVF YMGRAPKGTK TNWVMHEFRL HANLHNHHPN LRLNPKDEWV  180
VCKVFHKKQG DEAINNQQQQ PQYAAVDQYS AETPNSGSSV VQAGDIDGGD DFFQLDDIID  240
PSIYFVSNSS NILSAPPNNN NAVYSVSAST TTTNTTAVSF QQQPNYYSLI NKSSSSSSSN  300
YSAPLQQHVS SWNITPGAGG AHGIGSSYYN LQQQQAAMVK ALENVIAVPN FGTLLPSSNK  360
LKGLSKSAMA GLTQQNPLGV PQYKIENYGD HYISRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-501718818169NAC domain-containing protein 19
3swp_C5e-501718818169NAC domain-containing protein 19
3swp_B5e-501718818169NAC domain-containing protein 19
3swp_A5e-501718818169NAC domain-containing protein 19
3swm_D5e-501718818169NAC domain-containing protein 19
3swm_C5e-501718818169NAC domain-containing protein 19
3swm_B5e-501718818169NAC domain-containing protein 19
3swm_A5e-501718818169NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567642810.0
Expression AtlasQ5CD17-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Predominantly expressed in developing vascular tissue of the leaves and roots, and in developing flowers. {ECO:0000269|PubMed:15654622}.
UniprotTISSUE SPECIFICITY: Expressed in phloem. {ECO:0000269|PubMed:15654622}.
Function -- GeneRIF ? help Back to Top
  1. ONAC300 is a novel member of the NAC family which is expressed at very early developmental stages in the shoot, root and flower, as well as in the mature phloem of vascular tissues in rice.
    [PMID: 15654622]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g03050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g03050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1822780.0AB182278.1 Oryza sativa Japonica Group mRNA for ONAC300, complete cds.
GenBankAK2876660.0AK287666.1 Oryza sativa Japonica Group cDNA, clone: J065117E22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620530.10.0PREDICTED: NAC domain-containing protein 77
SwissprotQ5CD170.0NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLA0A0E0RD440.0A0A0E0RD44_ORYRU; Uncharacterized protein
STRINGLOC_Os12g03050.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP51203063
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.27e-71Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Kusano H,Asano T,Shimada H,Kadowaki K
    Molecular characterization of ONAC300, a novel NAC gene specifically expressed at early stages in various developing tissues of rice.
    Mol. Genet. Genomics, 2005. 272(6): p. 616-26
    [PMID:15654622]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]