PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g03040.1
Common NameLOC4351369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 394aa    MW: 43589.7 Da    PI: 6.6421
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g03040.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.87.5e-52111381128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+v+yL +++++ k+++  +i+ev+iyk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++l
  LOC_Os12g03040.1  11 LPPGFRFHPTDEELIVHYLMNQAASIKCPV-PIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL 102
                       79****************************.88***************8777899************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ ++ ++g+kk Lvfykg+ pkg+ktdW+mheyrl
  LOC_Os12g03040.1 103 STpTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRL 138
                       9988899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-647172IPR003441NAC domain
PROSITE profilePS5100559.06311172IPR003441NAC domain
PfamPF023652.4E-2612138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MPSSGGAMPA LPPGFRFHPT DEELIVHYLM NQAASIKCPV PIIAEVNIYK CNPWDLPGKA  60
LFGENEWYFF SPRDRKYPNG ARPNRAAGSG YWKATGTDKS ILSTPTSDNI GVKKALVFYK  120
GKPPKGVKTD WIMHEYRLTG TSANNTTTTK QRRASSMTMR LDDWVLCRIH KKSNDFNSSD  180
QHDQEPEGST VDEQLEDIHD NNSSSQQPPA PPDMNNQQSD FQPMTAMSMS KSCSLTDLLN  240
NLDCAALSQF LLDGSSDAIA ELPAPPSPLI YPNQTLNYNI NNNMPHAFES RLDHHDGYVN  300
NYNVNGLRRK RMMACSATSF DDGSSSSSSD FLHVAKKPLL LPSDSRGSGF GGGYCNQQLS  360
ETATGFQFQN GNMLSHPFPL NQQLLLNNHL QMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-731117815174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.796310.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976125700.0
Expression AtlasQ2QYD5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g03040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g03040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBX0004950.0BX000495.1 Oryza sativa chromosome 12, . BAC OSJNBb0119L20 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620532.10.0PREDICTED: NAC transcription factor 29
TrEMBLQ2QYD50.0Q2QYD5_ORYSJ; NAC domain transcription factor, putative, expressed
STRINGLOC_Os12g03040.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.15e-81NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]