PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g01490.1
Common NameLOC4351260, Os12g0105600, OsJ_34927, OSNPB_120105600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 315aa    MW: 34550.1 Da    PI: 7.8679
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g01490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97e-3157110255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  LOC_Os12g01490.1  57 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 110
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9253113IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2953111IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1554111IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2256112IPR006447Myb domain, plants
PfamPF002491.2E-858109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEKTSAGKEE GSESKTAAAN NDGSSTSSTT EEEESGESQR RTSSSSSVRP YIRSKNPRLR  60
WTPELHLSFV RAVDRLGGQD RATPKLVLQL MNVRGLSIGH VKSHLQMYRS KKIDESGQVI  120
GGGSWRSSDE QQYHHLQMQG GGDGGQAYNL GHLSLPAALH HRHITAGSGT ILQSRVANAW  180
SPWRCHGSYW LRAGHHLLVG SKPYYPPPPA EARANTSSNH PDFVQGSSSS PDDHTMNHQR  240
PVVLKEMIYN EGSNHQGGPL NLDLSLDICP RGEKRKRELI SWRKHEEDHD HTTIAIGGDQ  300
EAESCATGLS LSLF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.184480.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329925060.0
Expression AtlasQ2QYV2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g01490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g01490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1072970.0AK107297.1 Oryza sativa Japonica Group cDNA clone:002-126-C05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620339.10.0PREDICTED: probable transcription factor RL9
TrEMBLQ2QYV20.0Q2QYV2_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os12g01490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]