PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g01180.1
Common NameOs12g0102300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 457aa    MW: 50063.6 Da    PI: 7.171
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g01180.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.32.3e-31310366360
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       Dgy+WrKYGqK+vkgsefprsYY+Ct+++Cpvk+kve +  d+++ ei+Y+geHnh+k
  LOC_Os12g01180.1 310 DGYSWRKYGQKQVKGSEFPRSYYKCTHPTCPVKRKVEMTP-DGRIAEIVYNGEHNHPK 366
                       9***************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF540015.1E-4211227No hitNo description
PROSITE profilePS5060013.7819183IPR003653Ulp1 protease family, C-terminal catalytic domain
Gene3DG3DSA:3.30.310.1302.4E-683177No hitNo description
PfamPF029027.1E-690182IPR003653Ulp1 protease family, C-terminal catalytic domain
Gene3DG3DSA:2.20.25.801.4E-27302367IPR003657WRKY domain
PROSITE profilePS5081123.72303367IPR003657WRKY domain
SuperFamilySSF1182901.57E-24305367IPR003657WRKY domain
SMARTSM007741.7E-34308366IPR003657WRKY domain
PfamPF031062.0E-24310365IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006508Biological Processproteolysis
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0019784Molecular FunctionNEDD8-specific protease activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MAHGGGEEEE ERVLSHGDVV LLRCDLTILR GPHFLNDRII AFYLAHLAAD HHDDDLLLLP  60
PSVPYLLSNL PDPASVAAVA DPLRLASRRL VLLPVNDNPD VSHAEGGSHW TLLVLDNSNA  120
VSGPRFVHHD SLPPTNLPSA RRLAAVLRPL LPASAIPLIE GPTPRQTNGY DCGVFVLAVA  180
RAICNWWPTR ARHSNSDSDW LEAVKREVNA DSVKAMRTQL LQLIHTLIQN NTTTNQHSPS  240
TQLPSHPSIA STSLPVTAQD FGTWLEDSGT HTAYDQKKAD TGKGACWDNL TVSQSVRKPN  300
VSAKNSLSYD GYSWRKYGQK QVKGSEFPRS YYKCTHPTCP VKRKVEMTPD GRIAEIVYNG  360
EHNHPKPHPP RKPTLSTSVE TLVATNDAGL ENKLEGCDQA IGSDAVVEAL RGGCHCLDGF  420
RNGNEISDCK KRYAYAVIFI QNLLMFFCAK NVQVVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2bkq_A4e-26131845175SENTRIN-SPECIFIC PROTEASE 8
2bkq_B4e-26131845175SENTRIN-SPECIFIC PROTEASE 8
2bkq_C4e-26131845175SENTRIN-SPECIFIC PROTEASE 8
2bkq_D4e-26131845175SENTRIN-SPECIFIC PROTEASE 8
2bkr_A4e-26131845175SENTRIN-SPECIFIC PROTEASE 8
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.502580.0flower| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335192070.0
Expression AtlasQ7XA99-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g01180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g01180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418600.0AY341860.1 Oryza sativa (japonica cultivar-group) WRKY20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619786.10.0PREDICTED: uncharacterized protein LOC4351243
TrEMBLQ7XA990.0Q7XA99_ORYSJ; Os12g0102300 protein
STRINGLOC_Os12g01180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23252941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.14e-25WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]