PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os12g01120.1
Common NameLOC107275468, LOC107276476, LOC_Os11g01130, Os11g0102100, Os12g0101600, OsJ_031341, WOX3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 204aa    MW: 22352.1 Da    PI: 8.7607
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os12g01120.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.3e-21666257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  LOC_Os12g01120.1  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                      58*****************99**************************************97 PP

2Wus_type_Homeobox121.73.1e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
   LOC_Os12g01120.1  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
CDDcd000868.82E-4560No hitNo description
PfamPF000461.1E-18666IPR001356Homeobox domain
SuperFamilySSF466898.98E-12767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQQP SPPSSTVPPA PTAAAAGAVV QVHPAVMQLH HHHHHHHPYA  120
AAAAAQSHHL QQQQQQQAEW PAAVDYCSTA SASASATAAD MAIPPCCRPL KTLELFPTKS  180
TSGGLKEDCC SSSKSSSCST STN*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ33DK1
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf primordia, young leaves, floret meristems, floral organ primordia (except carpel primordium), stamens and carpels. Does not show polar expression pattern. {ECO:0000269|PubMed:17351053}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. Seems to act as repressor of YAB5. {ECO:0000269|PubMed:17351053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os12g01120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q33DK1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs12g01120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBX0725480.0BX072548.4 Oryza sativa chromosome 11, . BAC OSJNBa0029D01 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0005030.0BX000503.2 Oryza sativa chromosome 12, . BAC OSJNBb0077A02 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004960.0BX000496.1 Oryza sativa chromosome 12, . BAC OSJNBa0096E03 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAB2188930.0AB218893.1 Oryza sativa Japonica Group mRNA for OsWOX3 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616762.11e-149PREDICTED: WUSCHEL-related homeobox 3
RefseqXP_015619606.11e-149PREDICTED: WUSCHEL-related homeobox 3 isoform X2
SwissprotA2ZH471e-151WOX3_ORYSI; WUSCHEL-related homeobox 3
SwissprotQ33DK11e-151WOX3_ORYSJ; WUSCHEL-related homeobox 3
TrEMBLA0A0E0J5N41e-149A0A0E0J5N4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PFA51e-149A0A0E0PFA5_ORYRU; Uncharacterized protein
STRINGLOC_Os12g01120.11e-148(Oryza sativa Japonica Group)
STRINGBGIOSGA036831-PA1e-148(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55801121
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.18e-35WOX family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Nagasaki H,Matsuoka M,Sato Y
    Members of TALE and WUS subfamilies of homeodomain proteins with potentially important functions in development form dimers within each subfamily in rice.
    Genes Genet. Syst., 2005. 80(4): p. 261-7
    [PMID:16284419]
  3. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  4. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]