PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47920.1
Common NameLOC4351222, Os11g0706200, OsJ_34874, OSNPB_110706200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 594aa    MW: 66637 Da    PI: 6.3572
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47920.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.38.4e-882145832373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cA+a ++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+ +++ly+     ++ +++ +e l+++kl+  ++ + k++
  LOC_Os11g47920.1 214 RLLLIQCAQATATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGRGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFTKVA 301
                       568***************************************************9999994.....33446699******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        + a  +I++av+g++r+Hi+D++   Gl+Wp Ll+ L sR++gpp++RiT v+  ++     +++ee g+ L++ A+e++vpf+f++++a +
  LOC_Os11g47920.1 302 LMFAAMTIMQAVQGKKRLHIVDYGPRCGLHWPDLLRRLGSREDGPPEVRITIVDILQPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAAAK 394
                       ******************************************************99998999**************************9999* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalfd l+a+ p
  LOC_Os11g47920.1 395 WETVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNDSY-GASFLSRFRAVLLYYSALFDILDATTP 486
                       ********************************98776669******************9999888.789************************ PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s  r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++
  LOC_Os11g47920.1 487 RDSGLRLALEQNVLGPYALNAIACEGADLVERPEKYKQWQARNHRAGMQQLKLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGRILFA 579
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                        SaW
  LOC_Os11g47920.1 580 HSAW 583
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.443187564IPR005202Transcription factor GRAS
PfamPF035142.9E-85214583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PPPVFFDLPA TPLSNSDGTD PSSLDNQLLS YVSRMLMEDE  60
MGSSAAITNL QCVNRGSTEE ANNMLPGSEV VRVFSKGMGE ASKLLPRNNS FRTLETVDQV  120
SSDGHCRGRK KKNHDRDEQQ LEEELGRTSK LAALTIAGTQ EAGARELLDE LMLHAHETCI  180
KDMEKLRIDM DNEAEKKINK KDKKGSSSKV VDLRLLLIQC AQATATDNQQ SAGELLKKIK  240
QHALATGDAM QRVAHYFAKG LEARLAGRGK HLYQNQMRMS LVEYLKVYKL YMAACCFTKV  300
ALMFAAMTIM QAVQGKKRLH IVDYGPRCGL HWPDLLRRLG SREDGPPEVR ITIVDILQPA  360
FRPFQRIEEA GHCLSSCANE FRVPFRFQAV AAAKWETVGA EDLHIEPDEV LVVNDLWSFS  420
ALMDESVFCD GPNPRDVALR NISKMQPDVF IQGITNDSYG ASFLSRFRAV LLYYSALFDI  480
LDATTPRDSG LRLALEQNVL GPYALNAIAC EGADLVERPE KYKQWQARNH RAGMQQLKLR  540
PDIVDTIRDE VNKYHHKDFL LGEDGQWLLQ GWMGRILFAH SAWVRQSQDT SSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-282175838374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235240LKKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.147620.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906080.0
Expression AtlasQ53MB2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLQ53MB20.0Q53MB2_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g47920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-111GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]