PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47910.1
Common NameLOC4351220, Os11g0706000, OsJ_34873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 596aa    MW: 66666.1 Da    PI: 6.3725
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.33.9e-912165852373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+s+++ly+  +     +++ +e l+++kl+  ++ + k++
  LOC_Os11g47910.1 216 RMLLIQCAQAMATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGSGKHLYQ--NHV---RMSLVEYLKVYKLYMAACCFKKVA 303
                       679*********************************************************5..233...34489******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        + a  +I++av+g++r+Hi+D++i  Gl+Wp L++ L sR++gpp++RiT v+ p++g    +++e+ g+ L++ A+e++vpf+f+++va +
  LOC_Os11g47910.1 304 LMFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPGfrPFQRIEAAGHCLSSCANEFRVPFRFQAVVAAK 396
                       **********************************************************9999******************************* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e++  e+L+++p+E+l+Vn   +   l+des   +   +rd  L+ + +++P+v++    +  + ++sFl rf  al yysalfd+l+a+ p
  LOC_Os11g47910.1 397 WETVGAEDLHIEPDEVLVVNDLWSFSALMDESIFCDGpnPRDVALRNISKMQPDVFIQGIINGGY-GASFLSRFRGALLYYSALFDMLDATTP 488
                       ********************************87765559************************9.789************************ PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       res  r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++
  LOC_Os11g47910.1 489 RESGLRLALEQNVLGPYALNAIACEGADLVERPEKYRQWQARNHRAGMQQLKLRPDIVDTIREEVNKYHHKDFLLGEDGQWLLQGWMGRVLFA 581
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                        SaW
  LOC_Os11g47910.1 582 HSAW 585
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.388189566IPR005202Transcription factor GRAS
PfamPF035141.3E-88216585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PSPVFFELPP TPLANSDGST DPSSLLDNQL LSYVTSMLME  60
DEMGSSAAVT NLQCVNRGST EEANNMLPGS EVVRAFLKGM EEASKLLPRN NSFRMLETVD  120
QVSSHGHCRG GKKKNHDRDE QQLEEELGRS SKLAAMTNAG TEEAGARELL DELMLHSHET  180
CIKDMEKLRI DMDNEADKTI KKKGKKGSSS KVVDLRMLLI QCAQAMATDN QQSAGELLKK  240
IKQHALATGD AMQRVAHYFA KGLEARLAGS GKHLYQNHVR MSLVEYLKVY KLYMAACCFK  300
KVALMFAAMT IMQAVQGKKR LHIVDYGIRC GLHWPDLFRR LGSREDGPPE VRITIVDIPQ  360
PGFRPFQRIE AAGHCLSSCA NEFRVPFRFQ AVVAAKWETV GAEDLHIEPD EVLVVNDLWS  420
FSALMDESIF CDGPNPRDVA LRNISKMQPD VFIQGIINGG YGASFLSRFR GALLYYSALF  480
DMLDATTPRE SGLRLALEQN VLGPYALNAI ACEGADLVER PEKYRQWQAR NHRAGMQQLK  540
LRPDIVDTIR EEVNKYHHKD FLLGEDGQWL LQGWMGRVLF AHSAWVPQQQ DNSSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-322195858374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237242LKKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.147620.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906080.0
Expression AtlasQ53MB3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLQ53MB30.0Q53MB3_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g47910.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]